Primary Information |
---|
BoMiProt ID | Bomi8158 |
---|
Protein Name | Potassium channel subfamily K member 1 |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q0P5A0 |
---|
Milk Fraction | Exosomes |
---|
Ref Sequence ID | NP_001068675.1 |
---|
Aminoacid Length | 336 |
---|
Molecular Weight | 38041 |
---|
FASTA Sequence |
Download |
---|
Gene Name | KCNK1 |
---|
Gene ID | 505563 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | caput epididymis |
---|
Protein Function | It is a type of Ion channel that contributes to passive transmembrane potassium transport and to the regulation of the resting membrane potential in brain astrocytes, but also in kidney and in other tissues. Forms dimeric channels through which potassium ions pass in accordance with their electrochemical gradient. The channel is selective for K+ ions at physiological potassium concentrations and at neutral pH, but becomes permeable to Na+ at subphysiological K+ levels and upon acidification of the extracellular medium. The homodimer has very low potassium channel activity, when expressed in heterologous systems, and can function as weakly inward rectifying potassium channel. |
---|
PTMs | Disulfide bond formation,N-Linked Glycosylation at Asn, Isopeptide bond formation, Ubl conjugation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0P5A0|KCNK1_BOVIN Potassium channel subfamily K member 1 OS=Bos taurus OX=9913 GN=KCNK1 PE=2 SV=1
MLQSLAGSSCVRLVERHRSAWCFGFLVLGYLLYLVFGAVVFSSVELPYEDLLRQELRKLK
RRFLEEHECLSEPQLEQFLGRVLEASNYGVSVLSN*95ASGNWNWDFTSALFFASTVLSTTGY
GHTVPLSDGGKAFCIIYSVIGIPFTLLFLTAVVQRVTIHVTRRPVLYFHVRWGFSKQAVA
IVHAVLLGVVTVSCFFFIPAAVFSVLEDDWNFLESFYFCFISLSTIGLGDYVPGEGYNQK
FRELYKIGITCYLLLGLIAMLVVLETFCELHELKKFRKMFYVKKDKEEDQMHIIEHDQLS
FSSITDQAAGVQEDQKQNEPFVSPQPPALADGASDH
|
---|
Predicted Disorder Regions | 304-336 |
---|
DisProt Annotation | |
---|
TM Helix Prediction | 5TMHs; (20-42),(135-153),(178-200),(215-237),(244-266) |
---|
Significance of PTMs | Sumoylation of KCNK1 is sufficient to silence heterodimeric channels formed by KCNK1 and KCNK3 or KCNK9. |