Primary Information |
|---|
| BoMiProt ID | Bomi7926 |
|---|
| Protein Name | Phosducin-like protein 3 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q0VCW8 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001069113.1 |
|---|
| Aminoacid Length | 240 |
|---|
| Molecular Weight | 27479 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PDCL3 |
|---|
| Gene ID | 514033 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Phosducin-like protein 3 (PhLP3) forms a ternary complex with the ATP-dependent molecular chaperone CCT and its folding client tubulin.PhLP3 plays an inhibitory role in β-tubulin folding while conversely in vivo genetic studies suggest PhLP3 is required for the correct folding of β-tubulin. |
|---|
| PTMs | N-acetylation at Meth,Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0VCW8|PDCL3_BOVIN Phosducin-like protein 3 OS=Bos taurus OX=9913 GN=PDCL3 PE=2 SV=1
MQDPNADTEWNDILRKKGILPSKEDLKDLEKEAEEEEQRILQQS*44IVKTYEDMTLEELEDN
EDEFNEEDERAIEMYRQQRLAEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHL
YKQGIPLCALINQHLSALARKFPDVKFIKAISTTCIPSYPDRNLPTVFVYLEGDIKAQFI
GPLVFGGMNLTLDELEWKLSESGAIKTSLEENPKKPVEDVLLSAVRCSVPAKRDS*235DS*237EDD
|
|---|
| Predicted Disorder Regions | 1-70, 208-240 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | N-terminal methionine acetylation destabilizes the protein. |
|---|
| Additional Comments | Overexpression of PhLP3 has dramatic effects upon microtubule networks, disassembling the interphase microtubule array, mislocalising β-tubulin to nuclei |
|---|
| Bibliography | 1.Hayes NV, Jossé L, Smales CM, Carden MJ. Modulation of phosducin-like protein 3 (PhLP3) levels promotes cytoskeletal remodelling in a MAPK and RhoA-dependent manner. PLoS One. 2011;6(12):e28271. doi: 10.1371/journal.pone.0028271. Epub 2011 Dec 9. PMID: 22174782; PMCID: PMC3235111. 2. |
|---|
