Primary Information |
|---|
| BoMiProt ID | Bomi7897 |
|---|
| Protein Name | Peripherin |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A6QQJ3 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001095848.1 |
|---|
| Aminoacid Length | 469 |
|---|
| Molecular Weight | 53631 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PRPH |
|---|
| Gene ID | 510082 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | An intermediate filament present in peripheral and certain central nervous system neurons.Potential role during nerve growth factor (NGF)-promoted neuronal differentiation. |
|---|
| Biochemical Properties | Each subunit consists of a central alpha helical rod domain flanked by nonhelical N and C terminal domains. |
|---|
| PTMs | Phosphorylation,Nitration |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A6QQJ3|PERI_BOVIN Peripherin OS=Bos taurus OX=9913 GN=PRPH PE=2 SV=1
MSHPSGLRSSVSSTSYRRTFGPPPSLS*27PGAFSYSSSSRFSSSRLLGSAS*49PGSSVRLGS*58FR
GPRAGTGALLRLPSERLDFSMAEALNQEFLATRSNEKQELQELNDRFANFIEKVRFLEQQ
NAALRGELNQARGQEPARADQLCQQELRELRRELELLGRERDRVQVERDGLAEDLAALKQ
RLEEETRKREDAEHNLVLFRKDVDDATLSRLELERKIESLMDEIEFLKKLHEEELRDLQL
SVESQQVQHVEVEATVKPELTAALRDIRAQYESIAAKNLQEAEEWYKSKYADLSDAANRN
HEALRQAKQEMNESRRQIQSLTCEVDGLRGTNEALLRQLRELEEQFALEAGGYQAGAARL
EEELRQLKEEMARHLREYQELLNVKMALDIEIATYRKLLEGEESRISVPVHSFASLSIKT
TVPEVEPPQETHSRKMVLIRTIETRDGEQVVTESQKEQHSELDKSPQSY*469
|
|---|
| Predicted Disorder Regions | 1-30, 56-59, 141-143, 418-428, 454-469 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Peripherin is phosphorylated on Tyrosine-474 in rat has a role in modulating interaction with other proteins.Function of intermediate filament phosphorylation may reside in defining regional localizations within neurons. For example, nonphosphorylated neurofilaments arefound in somata and dendrites, while phosphoforms are more prevalent in axons.Phosphorylation increases after nerve injury in regenerating neurons. |
|---|
| Bibliography | 1.Aletta JM, Shelanski ML, Greene LA. Phosphorylation of the peripherin 58-kDa neuronal intermediate filament protein. Regulation by nerve growth factor and other agents. J Biol Chem. 1989 Mar 15;264(8):4619-27. PMID: 2538451. 2.Angelastro JM, Ho CL, Frappier T, Liem RK, Greene LA. Peripherin is tyrosine-phosphorylated at its carboxyl-terminal tyrosine. J Neurochem. 1998 Feb;70(2):540-9. doi: 10.1046/j.1471-4159.1998.70020540.x. PMID: 9453548. |
|---|
