Primary Information |
|---|
| BoMiProt ID | Bomi7883 |
|---|
| Protein Name | Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4/Parvulin-14/Peptidyl-prolyl cis-trans isomerase Pin4/PIase Pin4/Rotamase Pin4 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A6QPY8 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001099127.1 |
|---|
| Aminoacid Length | 131 |
|---|
| Molecular Weight | 13903 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PIN4 |
|---|
| Gene ID | 100126055 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | regulation of cell cycle progression, metabolic pathways and ribosome biogenesis. |
|---|
| Biochemical Properties | peptidyl-prolyl cis-trans isomerase activity. |
|---|
| PTMs | Phosphorylation on Tyr and Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A6QPY8|PIN4_BOVIN Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 OS=Bos taurus OX=9913 GN=PIN4 PE=2 SV=1
MPPKGKSGSGKGGKGKAAS*19GSESSEKKAQGPKGGGNAVKVRHILCEKHGKILEAMEKLKS
GMKFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPISVLDKPVFTDPPVKTKF
GYHIIMVEGRK
|
|---|
| Predicted Disorder Regions | (1-40) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | tyrosine-122 (Tyr-122) of PIN4 is phosphorylated in a subset of glioblastoma cases expressing the oncogenic fusionprotein FGFR3-TACC3 (F3-T3).It is an important intermediate step in F3-T3-induced activation of oxidative phosphorylation and mitochondrial biogenesis in glioblastoma cells. Phosphorylation at Ser-19 does not affect its PPIase activity but is required for nuclear localization, and the dephosphorylation is a prerequisite for the binding to DNA. The unphosphorylated form associates with the pre-rRNP complexes in the nucleus. |
|---|
| Bibliography | Stifani S. The Multiple Roles of Peptidyl Prolyl Isomerases in Brain Cancer. Biomolecules. 2018 Oct 11;8(4):112. doi: 10.3390/biom8040112. PMID: 30314361; PMCID: PMC6316532. |
|---|
