Primary Information |
|---|
| BoMiProt ID | Bomi7833 |
|---|
| Protein Name | Parvalbumin alpha |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q0VCG3 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001069582.1 |
|---|
| Aminoacid Length | 110 |
|---|
| Molecular Weight | 12082 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | PVALB |
|---|
| Gene ID | 538603 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | involved in relaxation after contraction. EF-hand type proteins.During nervous system development, its expression accompanies the maturation of functional circuits. |
|---|
| Biochemical Properties | It binds two calcium ions .beta parvalbumin differs in 54 positions from alpha parvalbumin and lacks the C-terminal amino acid 109. |
|---|
| Significance in milk | Calcium binding properties |
|---|
| PTMs | Acetylation on Ser, Phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0VCG3|PRVA_BOVIN Parvalbumin alpha OS=Bos taurus OX=9913 GN=PVALB PE=3 SV=3
MS*2MTDLLHAEDIKKAVGAFTAVDS*24FDHKKFFQMVGLKKKSPEDVKKVFHILDKDKSGFIE
EEELGFILKGFSPDARDLSVKETKTLLAAGDKDGDGKIGADEFSTLVAES
|
|---|
| Predicted Disorder Regions | 3 disordered segments; (1-4), (33-83), (90-95) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Vologzhannikova AA, Shevelyova MP, Kazakov AS, Sokolov AS, Borisova NI, Permyakov EA, Kircheva N, Nikolova V, Dudev T, Permyakov SE. Strontium Binding to α-Parvalbumin, a Canonical Calcium-Binding Protein of the "EF-Hand" Family. Biomolecules. 2021 Aug 5;11(8):1158. doi: 10.3390/biom11081158. PMID: 34439824; PMCID: PMC8392015. |
|---|
