Primary Information |
|---|
| BoMiProt ID | Bomi7756 |
|---|
| Protein Name | Osteopontin-K |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P31098 |
|---|
| Milk Fraction | Whey |
|---|
| Aminoacid Length | 277 |
|---|
| Molecular Weight | 30969 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | N/A |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Involved in cell adhesion |
|---|
| Biochemical Properties | The N-terminal amino acid region of pBk2.1 ,which cDNA of bovine renal osteopontin-k,(the first 82 amino acids) and 42 amino acids at the C terminus had the highest level of homology with the osteopontins at 86%. The middle portion of the peptide had greatly reduced homology, ranging from 50% (amino acids 83–174) to 12% (amino acids 175–219). |
|---|
| PTMs | Glycosylation, Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P31098|OSTK_BOVIN Osteopontin-K OS=Bos taurus OX=9913 PE=2 SV=1
MRIAVICFCLLGIASALPVKPTS*23S*24GS*26S*27EEKQLNNKYPDAVATWLKPDPSQKQTFLAPQNS*60
VS*62S*63EETDDNKQNTLPS*76KS*78NEDPEQTDDLDDDDDNS*95QDVNS*100N*101DS*103DDAETTDDPDHS*115DESHHSDES*124HQVHFPTDIPTIAVFTPFIPTESANDGRGDRCGLRTEVKIIEVPPINVQSPDAT*178EEDFTS*184HIES*188ERCMSTKKTSRLTDHS*204KETNRCELSKELMPKAKDKNKHSNLIES*232QENSKLS*239QEFHS*244LEDKLDLDHKS*255EEDKHLKIRIS*266HELDS*271AS*273SEVN
|
|---|
| Predicted Disorder Regions | 1-277 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | It has a potential glycosylation site (Asn-X-Ser/Thr) which is responsible for binding to GRGDS receptor. |
|---|
| Bibliography | Crivello JF, Delvin E. Isolation and characterization of a cDNA for osteopontin-k: a kidney cell adhesion molecule with high homology to osteopontins. J Bone Miner Res. 1992 Jun;7(6):693-9. doi: 10.1002/jbmr.5650070614. PMID: 1414488. |
|---|
