Primary Information |
---|
BoMiProt ID | Bomi7739 |
---|
Protein Name | Oligoribonuclease, mitochondrial/RNA exonuclease 2 homolog/Small fragment nuclease |
---|
Organism | Bos taurus |
---|
Uniprot ID | A2VE52 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_001075204.1 |
---|
Aminoacid Length | 237 |
---|
Molecular Weight | 26885 |
---|
FASTA Sequence |
Download |
---|
Gene Name | REXO2 |
---|
Gene ID | 540139 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | oligoribonuclease activity.ability to degrade small single-stranded RNA and DNA fragments. |
---|
Biochemical Properties | REXO2 has conserved two AUG translation initiation sites.3' to 5' exonuclease activity specific.Maintaining Mitochondrial Structure.its depletion Severely Affects Mitochondrial Nucleic Acid Content.Cofactor for this enzyme is Mn2+ or Mg2+. |
---|
PTMs | Acetylation and phosphorylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A2VE52|ORN_BOVIN Oligoribonuclease, mitochondrial OS=Bos taurus OX=9913 GN=REXO2 PE=2 SV=1
MLGGSLGSRLLRGVGGTRGQFRARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQI
IEMACLITDSDLNILAEGPNLIIKQPDELLDS*92MSDWCKEHHGKSGLTKAVKESTMTLQQA
EY*122EFLSFVRQQTPPGLCPLAGNSVHADKKFLDKYMPQFMKHLHYRIIDVSTVKELCRRWY
PEEYEFAPKKAASHRALDDISESIKELQFYRNNIFKKKTDEKKRKIIENGENEKTVS
|
---|
Predicted Disorder Regions | 2 disordered segments; (1-9), (219-237) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | REXO2 depletion also has a negative effect on both replication and transcription in mitochondria, causing a robust depletion of mtDNA and of mtRNAs |
---|
Bibliography | Bruni F, Gramegna P, Oliveira JM, Lightowlers RN, Chrzanowska-Lightowlers ZM. REXO2 is an oligoribonuclease active in human mitochondria. PLoS One. 2013 May 31;8(5):e64670. doi: 10.1371/journal.pone.0064670. PMID: 23741365; PMCID: PMC3669425. |