Primary Information |
|---|
| BoMiProt ID | Bomi7630 |
|---|
| Protein Name | Nuclear autoantigenic sperm protein |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2T9P4 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001033177.2 |
|---|
| Aminoacid Length | 777 |
|---|
| Molecular Weight | 83688 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | NASP |
|---|
| Gene ID | 512427 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Nuclear autoantigenic sperm protein (NASP) is associated with DNA replication, cell proliferation, and cell cycle progression through its specific binding to histones. |
|---|
| Biochemical Properties | A multichaperone nucleosome-remodeling complex that contains the H1 linker histone chaperone nuclear autoantigenic sperm protein (NASP) has recently been described. Linker histones (H1) are required for the proper completion of normal development, and NASP transports H1 histones into nuclei and exchanges H1 histones with DNA. |
|---|
| PTMs | N6-Acetylation at Lys, Isopeptide bond formation, Phosphorylation at Ser/Thr, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2T9P4|NASP_BOVIN Nuclear autoantigenic sperm protein OS=Bos taurus OX=9913 GN=NASP PE=2 SV=2
MAAESTATAAITAELVSADKIEEDAPAPSTSADKVESLDVDSEAKKLLGLGQKHLVMGDI
PAAVNAFQEAASLLGKKYGETANECGEAFFFYGKSLLELARMENGVLGNALEGVHVEEEE
GEKT*124EEES*128LVENNDNIDEEAREELREQVYDAMGEKEAQKTEDKSLVKPEMDKEQETEMEK
GGREDMDIGEPAEELQEKVKSAPDQLTETTEEGKGAAAPEGLSEAEVTSKKPDQEIPGAE
EGKS*244VSETDVQEECREKGGQGEVIVSIEEKPKEASKEQPVVTLEKQGTPVEIEAVKPVDM
GGDEPKEQVAAS*312ESERGKAILEQLVGQELPSAEESPEVTTQAADASAAEAGSEVSEKPGG
QDTVLPQDGAVNGLSAAGDHASTKPQTNAEGLIGTKDGS*399ALEKVRAELVPS*411QETKLSVEE
SEAAGDGVETEVAQGATEQS*440PEDKVKIAANEEAQDKEEQMKEGEET*466EGS*469EEEDKENDKAE
ETLNDS*486ALENKS*492LQENEEEEIGNLELAWDMLDLAKIIFKRQDTKEAQLYAAQAHLKLGEV
SVESENYLQAVEEFQACLNLQEQYLEAHDRLLAETHYQLGLAYGYNSQYDEAVAQFSKSI
EVIEKRMAVLNEQMKEAEGSPTEYEKEIEELKELLPEIREKIEDAKESQRS*651GNVAELALK
ATLVESSTSGFT*672PSGGSSSVSMIASRKPTDGASS*694S*695NCVTDISHLVRKKRKPEEES*715PRKDDAKKAKQEPEVNGGS*734GDTISTGTEVAENMEEEAENKAESRAAVEGTVEAGATVESTAC
|
|---|
| Predicted Disorder Regions | 1-40, 115-497, 631-641, 665-777 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | Mutation of nuclear autoantigenic sperm protein (NASP) gene aggravates autoimmune response in induced lupus model mice |
|---|
| Bibliography | 1.Nagatomo H, Kohri N, Akizawa H, Hoshino Y, Yamauchi N, Kono T, Takahashi M, Kawahara M. Requirement for nuclear autoantigenic sperm protein mRNA expression in bovine preimplantation development. Anim Sci J. 2016 Mar;87(3):457-61. doi: 10.1111/asj.12538. Epub 2015 Dec 22. PMID: 26690724. 2.Zhan Q, Zhang J, Wang H, Wu X, Zhu Y, Xu Z, Ju J. [Mutation of nuclear autoantigenic sperm protein (NASP) gene aggravates autoimmune response in induced lupus model mice]. Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2019 Sep;35(9):776-782. Chinese. PMID: 31750817. 3.Richardson RT, Alekseev OM, Grossman G, Widgren EE, Thresher R, Wagner EJ, Sullivan KD, Marzluff WF, O'Rand MG. Nuclear autoantigenic sperm protein (NASP), a linker histone chaperone that is required for cell proliferation. J Biol Chem. 2006 Jul 28;281(30):21526-21534. doi: 10.1074/jbc.M603816200. Epub 2006 May 25. PMID: 16728391. |
|---|
