Primary Information |
|---|
| BoMiProt ID | Bomi7531 |
|---|
| Protein Name | N-lysine methyltransferase KMT5A/H4-K20-HMTase KMT5A/Histone-lysine N-methyltransferase KMT5A /Lysine-specific methylase 5A/PR/SET domain-containing protein 07/SET domain-containing protein 8 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2YDJ8 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001039795.1 |
|---|
| Aminoacid Length | 352 |
|---|
| Molecular Weight | 39277 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | KMT5A/SETD8 |
|---|
| Gene ID | 532622 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | KMT5A serves a vital role in ccRCC (Clear cell renal cell carcinoma) development and progression, and it may be a novel target for ccRCC treatment and prevention. |
|---|
| Biochemical Properties | N-lysine methyltransferase 5A (KMT5A or SET8/PR-Set7), which methylates lysine 20 in histone H4, bound α-tubulin and methylated it at a specific lysine residue |
|---|
| PTMs | Acetylation, Phosphorylation, Ubl conjugation, Isopeptide bond formation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2YDJ8|KMT5A_BOVIN N-lysine methyltransferase KMT5A OS=Bos taurus OX=9913 GN=KMT5A PE=2 SV=1
MARGRKMSKPRAVEAAAAAAAVAATAPGPEMVERRGPGRPRTNGENVFTGQSKIYTYMS*59P
NKCSGMRSPLQEENSVAQYEVKCQGKPLAGIYRKRDEKRNSGNAIRSSMKAEEQKIKDAR
RGPLAPFPNQKSEAAEPPKT*140PTSSCDTPNAAAAKQGLKKPVRGKQAPRKKAQGKTQQNRK
LTDFYPVRRSSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGE
FVVEYHGDLIEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHS
KCGNCQTKLHDIDGVPHLILIASRDIEAGEELLYDYGDRSRASIEAYPWLKH
|
|---|
| Predicted Disorder Regions | 1-176, 183-201 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | KMT5A promotes metastasis of clear cell renal cell carcinoma through reducing cadherin-1 expression |
|---|
| Bibliography | 1.Lin ZZ, Ming DS, Chen YB, Zhang JM, Chen HH, Jiang JJ, Zhang ZS. KMT5A promotes metastasis of clear cell renal cell carcinoma through reducing cadherin-1 expression. Oncol Lett. 2019 Jun;17(6):4907-4913. doi: 10.3892/ol.2019.10163. Epub 2019 Mar 19. PMID: 31186699; PMCID: PMC6507477. 2.Chin HG, Esteve PO, Ruse C, Lee J, Schaus SE, Pradhan S, Hansen U. The microtubule-associated histone methyltransferase SET8, facilitated by transcription factor LSF, methylates α-tubulin. J Biol Chem. 2020 Apr 3;295(14):4748-4759. doi: 10.1074/jbc.RA119.010951. Epub 2020 Feb 28. PMID: 32111740; PMCID: PMC7135998. |
|---|
