Primary Information |
|---|
| BoMiProt ID | Bomi7446 |
|---|
| Protein Name | Neuromodulin/Axonal membrane protein GAP-43/Calmodulin-binding protein P-57/Growth-associated protein 43 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P06836 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_976234.2 |
|---|
| Aminoacid Length | 242 |
|---|
| Molecular Weight | 25066 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | GAP43 |
|---|
| Gene ID | 281777 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | neuron growth and regeneration.Neurospecific calmodulin binding protein that is implicated in neurite extension, axonal elongation and long-term potentiation.neuromodulin binds and concentrates calmodulin on growth cone membranes and that stimulation of protein kinase C releases high local concentrations of calmodulin in the growth cone. |
|---|
| Biochemical Properties | A nine amino acid fragment (RGHITRKKL) has been identified as the putative calmodulin binding domain of neu~romodulin.bovine brain neuromodulin Tertiary and secondary structure(predicted by circular dichreism spectroscopy) ~-helix 1% IB-sheet 21% random coil 78%.Amino acid composition Ala 24% Pro 9% acidic amino acids 32%. |
|---|
| PTMs | Palmitatoylation, Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P06836|NEUM_BOVIN Neuromodulin OS=Bos taurus OX=9913 GN=GAP43 PE=1 SV=3
MLCCMRRTKQVEKNDEDQKIEQDGIKPEDKAHKAATKIQAS*41FRGHITRKKLKGEKKGDAP
AAEAEANEKDEAAVAEGTEKKEGEGS*86TPAEAAPGAGPKPEEKTGKAGETPSEEKKGEGAP
DAATEQAAPQAPAPSEEKAGSAETESATKASTDNS*155PS*157S*158KAEDAPAKEEPKQADVPAAVTA
AAATAPAAEDAAAMATAQPPTETAES*206S*207QAEEKIEAVDETKPKDSARQDEGKGEEREADQE
HA
|
|---|
| Predicted Disorder Regions | 1 disordered segment; (1-242) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylation of this protein by a protein kinase C is specifically correlated with certain forms of synaptic plasticity.Palmitoylation is regulated by ARF6 and is essential for plasma membrane association and axonal and dendritic filopodia induction |
|---|
| Bibliography | Liu YC, Storm DR. Regulation of free calmodulin levels by neuromodulin: neuron growth and regeneration. Trends Pharmacol Sci. 1990 Mar;11(3):107-11. doi: 10.1016/0165-6147(90)90195-e. PMID: 2151780. |
|---|
