Primary Information |
|---|
| BoMiProt ID | Bomi7406 |
|---|
| Protein Name | Negative elongation factor E/NELF-E/RNA-binding protein RD |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q0V898 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001069672.1 |
|---|
| Aminoacid Length | 374 |
|---|
| Molecular Weight | 42331 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | NELFE/RDBP |
|---|
| Gene ID | 540158 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | negatively regulates the elongation of transcription by RNA polymerase II |
|---|
| Biochemical Properties | NELF is composed of five polypeptides, the smallest of which is identical to RD(Arg-Asp residues (RD motif)), a putative RNA-binding protein. DSIF and NELF are capable of repressing transcription at any point downstream of +50–60.NELF can only associate with, and inhibit, hypophosphorylated pol II. |
|---|
| PTMs | formation of isopeptide bond,sumoylation,ADP-ribosylation,phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q0V898|NELFE_BOVIN Negative elongation factor E OS=Bos taurus OX=9913 GN=NELFE PE=2 SV=1
MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTASQGGVKRSLS*51EQPVVDTAT
ATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRS*113VS*115ADDDL
QESSRRPQRKS*131LYESFVSS*139SDRLRELGPDGEEAEGPGAGDGPPRS*165FDWGYEERGGARSS*179AS*181PPRS*185RSRDRSRERNRDRDRDRDRERDRERDRDRDRDRERDRDRDRDRDRDRERDREGPF
RRS*243DS*245FPERRAPRKGNTLYVYGEDMT*266PT*268LLRGAFS*275PFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVSIARKQPMLDAATGKSVWGSLAVQNS*347PKGCHRDKRTQIV
YSDDVYKENLVDGF
|
|---|
| Predicted Disorder Regions | 3-248, 259-262, 327-334 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | ADP-ribosylation of NELF proteins by Poly(ADP-ribose) polymerases (PARPs) promotes transcription elongation.Also phosphorylated by CDK9 which helps in alleviating their repressive effect on transcription elongation . |
|---|
| Bibliography | 1.Zlotorynski, E. ADP-ribosylation promotes transcription elongation. Nat Rev Mol Cell Biol 17, 397 (2016). https://doi.org/10.1038/nrm.2016.83 2.Chen L, Keppler OT, Schölz C. Post-translational Modification-Based Regulation of HIV Replication. Front Microbiol. 2018 Sep 11;9:2131. doi: 10.3389/fmicb.2018.02131. PMID: 30254620; PMCID: PMC6141784. |
|---|
