Primary Information |
---|
BoMiProt ID | Bomi7319 |
---|
Protein Name | Myotrophin |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q3T0F7 |
---|
Milk Fraction | Exosomes |
---|
Ref Sequence ID | NP_976238.2 |
---|
Aminoacid Length | 118 |
---|
Molecular Weight | 12895 |
---|
FASTA Sequence |
Download |
---|
Gene Name | MTPN |
---|
Gene ID | 541099 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Presence in other biological fluids/tissue/cells | occipital lobe |
---|
Protein Function | It may play a role in the initiation of cardiac hypertrophy as well as in normal growth of cardiac myocytes in humans. |
---|
PTMs | Phosphorylation at Thr,N-Acetylation at Lys |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T0F7|MTPN_BOVIN Myotrophin OS=Bos taurus OX=9913 GN=MTPN PE=1 SV=3
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRT*31LEGGRKPLHYAADCGQLEILEFLLLKGAD
INAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
|
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | 1.Sil P, Misono K, Sen S. Myotrophin in human cardiomyopathic heart. Circ Res. 1993 Jul;73(1):98-108. doi: 10.1161/01.res.73.1.98. PMID: 8508536. 2. |