Primary Information |
|---|
| BoMiProt ID | Bomi7288 |
|---|
| Protein Name | Myocyte-specific enhancer factor 2C |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2KIA0 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001039578.1 |
|---|
| Aminoacid Length | 441 |
|---|
| Molecular Weight | 47844 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | MEF2C |
|---|
| Gene ID | 512254 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | cardiac morphogenesis and muscle differentiation, and is also involved in vascular development.Role in hippocampal-dependent learning and memory.Required for B-cell survival and proliferation in response to BCR stimulation. Involved in neurogenesis.MEF2C interacts with Sox18 for endothelial vessel morphogenesis.The interaction of MEF2C with Cabin1 is important for maintaining T-cell inactivation. |
|---|
| Biochemical Properties | beta domain is for transcriptional activity.At the N-terminus of MEF2C, there are 56 amino acids in the MADS domain. This region is highly conserved and rich of A-T base pairs. The region's main role is to mediate DNA binding, dimerization, and co-factor interactions.Adjacent to the MEF2 domain is the HJURP-C (Holliday junction recognition protein C-terminal) domain, consisting of 29 amino acids.The NLS domain (nuclear localization signal) is located at the C-terminus of MEF2C, which controls nuclear translocation of the protein. |
|---|
| Significance in milk | myeloid progenitor proliferation |
|---|
| PTMs | Phosphorylation and Acetylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2KIA0|MEF2C_BOVIN Myocyte-specific enhancer factor 2C OS=Bos taurus OX=9913 GN=MEF2C PE=2 SV=1
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAS*59T
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDS*98PDPDADDS*106VGHS*110PESEDKYRKI
NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN
SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNS*222PGLLVS*228PGNLNKNMQAKS*240
PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLAT*293PVVSVAT*300
PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHSMPP
SALSQLGDRTTTPSRYPQHTRHEAGRS*387PVDSLSSCSSSYDGSDREDHRNEFHS*413PIGLTRP
SPDERESPSVKRMRLSEGWAT
|
|---|
| Predicted Disorder Regions | 7 disordered segments;(190-196), (208-229), (286-300),( 311-339), (365-372), (390-423), (435-441) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylation on Ser-59 enhances DNA binding activity.Acetylation on Lys-4 increases DNA binding and transactivation. |
|---|
| Additional Comments | It has been reported that MEF2C-knockout mice die on embryonic day 9.5 from unnatural development of cardiovascular. |
|---|
| Bibliography | Dong C, Yang XZ, Zhang CY, Liu YY, Zhou RB, Cheng QD, Yan EK, Yin DC. Myocyte enhancer factor 2C and its directly-interacting proteins: A review. Prog Biophys Mol Biol. 2017 Jul;126:22-30. doi: 10.1016/j.pbiomolbio.2017.02.002. Epub 2017 Feb 3. PMID: 28163053. |