Search by BoMiProt ID - Bomi7277


Primary Information

BoMiProt ID Bomi7277
Protein Name Myelin protein zero-like protein 1
Organism Bos taurus
Uniprot IDQ32PI9
Milk FractionExosomes
Ref Sequence ID NP_001069626.1
Aminoacid Length 269
Molecular Weight 29314
FASTA Sequence Download
Gene Name MPZL1
Gene ID 539387
Protein Existence Status Reviewed

Secondary Information

Presence in other biological fluids/tissue/cells pigment epithelium of eye 
Protein Function Myelin protein zero-like protein 1 (MPZL1) is a member of the immunoglobulin superfamily, and is also a receptor of concanavalin A (ConA). 
Biochemical Properties Myelin protein zero-like protein 1 (MPZL1/PZR) is a single transmembrane glycoprotein comprised of an extracellular receptor domain and an intracellular domain with two immunoreceptor tyrosine-based inhibitory motifs (ITIMs).The phosphorylated ITIM motifs specially bind SH2 domains of a tyrosine phosphatase SHP-2/PTPN11.
PTMs Disulfide bond formation,N-Linked Glycosylation at Asn, Phosphrylation at Ser/tyr
Site(s) of PTM(s)

N-glycosylation, O-glycosylation,
Phosphorylation
>sp|Q32PI9|MPZL1_BOVIN Myelin protein zero-like protein 1 OS=Bos taurus OX=9913 GN=MPZL1 PE=2 SV=1 MAAPAGAGALIASPDRRRCLWSVLAAALGLLTYGVSALEVYTPKEIFVAN*50GTQGKLTCKF KSTN*64TTGTLTSVSWSFQPEGTDTTVSFFHYSQGQVYAGNYPPFKDRVSWAGDLDKKDASI NIENMQFIHN*130GTYICDVKNPPDIVVQPGHIRLYVVEKEILPAFPVWVVVGIVTAVVLGLT LLITMILAVIYRRRNSKRDYAGCNTS*206ENVS*210PVKQVSRKS*219PS*221DTEGLVKSLPSGSHQGPVIY*241AQLDHSGGHHSDRINKSES*260VVY*263ADIRKN
Predicted Disorder Regions 1-6, 201-238, 246-259
DisProt Annotation
TM Helix Prediction 2TMHs; (20-38) & (169-191)
Significance of PTMs Phosphorylation at Tyr-241 and Tyr-263 is required for interaction with PTPN11/SHP-2.
Additional Comments MPZL1 is upregulated in hepatocellular carcinoma (HCC) and accelerates migration of HCC cells. 
Bibliography 1.Yu T, Liang L, Zhao X, Yin Y. Structural and biochemical studies of the extracellular domain of Myelin protein zero-like protein 1. Biochem Biophys Res Commun. 2018 Dec 2;506(4):883-890. doi: 10.1016/j.bbrc.2018.10.161. Epub 2018 Nov 2. PMID: 30392906. 2.R. Zhao, Z.J. Zhao, Dissecting the interaction of SHP-2 with PZR, an immunoglobulin family protein containing immunoreceptor tyrosine-based inhibitory motifs, J. Biol. Chem. 275 (2000) 5453e5459. 3.R. Zhao, Z.J. Zhao, Identification of a variant form of PZR lacking immunoreceptor tyrosine-based inhibitory motifs, Biochem. Biophys. Res. Commun. 303 (2003) 1028e1033. 4. Z.J. Zhao, R. Zhao, Purification and cloning of PZR, a binding protein and putative physiological substrate of tyrosine phosphatase SHP-2, J. Biol. Chem.273 (1998) 29367e29372. 5. M.G. Roubelakis, E. Martin-Rendon, G. Tsaknakis, A. Stavropoulos, S.M. Watt,The murine ortholog of the SHP-2 binding molecule, PZR accelerates cell migration on fibronectin and is expressed in early embryo formation, J. Cell.Biochem. 102 (2007) 955e969. 6. R. Zhao, X. Fu, L. Teng, Q. Li, Z.J. Zhao, Blocking the function of tyrosine phosphatase SHP-2 by targeting its Src homology 2 domains, J. Biol. Chem. 278 (2003) 42893e42898.