Primary Information |
|---|
| BoMiProt ID | Bomi7231 |
|---|
| Protein Name | mRNA decay activator protein ZFP36/ tristetraprolin/Zinc finger protein 36 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P53781 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_776918.1 |
|---|
| Aminoacid Length | 324 |
|---|
| Molecular Weight | 34087 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ZFP36 |
|---|
| Gene ID | 282127 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | In response of endothelial cells to hypoxia this gene promotes ARE-mediated mRNA decay of hypoxia-inducible factor HIF1A mRNA.Positively regulates early adipogenesis of preadipocytes by promoting ARE-mediated mRNA decay of immediate early genes (IEGs).Plays a role in maintaining skeletal muscle satellite cell quiescence by promoting ARE-mediated mRNA decay of the myogenic determination factor MYOD1 mRNA. Plays a role in the regulation of keratinocyte proliferation, differentiation and apoptosis. Plays a role as a tumor suppressor by inhibiting cell proliferation in breast cancer cells. |
|---|
| Significance in milk | differentially expressed during peripartum period |
|---|
| PTMs | Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P53781|TTP_BOVIN mRNA decay activator protein ZFP36 OS=Bos taurus OX=9913 GN=ZFP36 PE=2 SV=1
MDLAAIYKSLLSLSPELPSDLGETESSTSWASSGPWSLSSSDSSLPEVAARLPGRSTS*58LV
EGRS*64CGWVPPPPGFAPLAPRPSSDWS*86PS*88PT*90S*91PTATPTTSSRYKTELCRTFSESGRCRYGA
KCQFAHGLGELRQASRHPKYKTELCHKFYLQGRCPYGSRCHFIHNPS*167EDLAAPGHPHVLR
QSIS*184FSGLPSGRRTS*195PPPASLAGPSVSSWSFSPSSS*216PPPPPGDLLLS*227PSAFSAAPGHLCRRDPTPACCPSCRRATPNSVWGPVGGLARSPSAHS*274LGSDPDEYASSGTSLGGSDS*294PVFEAG
VFGPPQPPAAPRRLPIFNRIS*321VSE
|
|---|
| Predicted Disorder Regions | 4 disordered segments; (16-102), (193-201), (213-216), (229-324) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | phosphorylation increases its stability and cytoplasmic localization and regulates binding to 14-3-3 adapter proteins |
|---|
| Additional Comments | ZFP36 inhibits nuclear factor-κB transcriptional activation and also binds to cytokine mRNAs, leading to reduced transcript stability.mRNA-binding protein ZFP36 is expressed in atherosclerotic lesions and reduces inflammation in aortic endothelial cells. |
|---|
| Bibliography | Zhang H, Taylor WR, Joseph G, Caracciolo V, Gonzales DM, Sidell N, Seli E, Blackshear PJ, Kallen CB. mRNA-binding protein ZFP36 is expressed in atherosclerotic lesions and reduces inflammation in aortic endothelial cells. Arterioscler Thromb Vasc Biol. 2013 Jun;33(6):1212-20. doi: 10.1161/ATVBAHA.113.301496. Epub 2013 Apr 4. PMID: 23559629; PMCID: PMC3844532. |
|---|
