Primary Information |
|---|
| BoMiProt ID | Bomi7223 |
|---|
| Protein Name | M-phase inducer phosphatase 3/Dual specificity phosphatase Cdc25C |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A5D7P0 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001091465.1 |
|---|
| Aminoacid Length | 477 |
|---|
| Molecular Weight | 53794 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CDC25C |
|---|
| Gene ID | 507731 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | CDC25C is a cyclin of the specific phosphatase family that activates the cyclin B1/CDK1 complex in cells for entering mitosis and regulates G2/M progression and plays an important role in checkpoint(G2/M progression) protein regulation in case of DNA damage, which can ensure accurate DNA information transmission to the daughter cells.It can promote mitotic cell G2/M transition by triggering cyclin-dependent kinase-1 (CDK1) dephosphorylation to activate the cyclin B1/CDK1 complex |
|---|
| Biochemical Properties | Bispecific phosphatase which hydrolyzes Tyr and Ser/Thr phosphate.CDC25C acts on the CDK1 Thr14 and Tyr15 residues, dephosphorylating them, and activating this complex into mitosis.During interphase, CDC25C shuttles from the cytoplasm to the nucleus.14-3-3 and CDC25C can form a complex and localised to the cytoplasm. |
|---|
| PTMs | Phosphorylation,Acetylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A5D7P0|MPIP3_BOVIN M-phase inducer phosphatase 3 OS=Bos taurus OX=9913 GN=CDC25C PE=2 SV=1
MSAEFFSSKREEGSLASGPS*20FRSNQRKILNLLLERDAS*38FSISSDLPTT*48PVEKKLFGDS*58AN
LS*62ILS*65GGT*68PKRCLDLSNLSSGEMSATQLTASADLDETGHLESTGPEQVRLAGMNYRQHLI
KCS*123PAQLFCS*130T*131PNALEHGRRKKDAICGSSANKENDNGNLVENEMKHLGS*169PITTVSKLHKNPELAEDQAEEIS*192DELMEFS*199LEDQEKAKPPLNWSSLYRS*218SS*220LPDSLNSPSLKQVVKFKDSTIPDKLKKKYCSNQKELGKGLGLKKMVSLCDINMTQMLEEDSNQGPLIGDFSKVCALPTVS
GKHQDLKYVNPETVAALLSGEFQGLIEKFYIIDCRYPYEYLGGHIQGALNLHSQEELYNF
FLKKPIVPWDNQKRIVIVFHCEFSSERGPRMCRSLREEDRTLNQYPALYYPELYILKGGY
RDFFPEYMELCEPQSYCPMHHQDHKAELLRCRNQSKAWEGERQLQEQIALLVKDVS*476P
|
|---|
| Predicted Disorder Regions | 1-20, 82-106, 139-156, 167-225, 236-263 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylation of CDC25C on Ser216 and Ser287(binding sites for 14-3-3 protein) at the interphase prevents its activation and promotes cytoplasmic location by binding to 14-3-3 protein.When Ser191 and Ser198 in NES of CDC25C are phosphorylated, it facilitates nuclear translocation of CDC25C.In G2/M progression, activation of CDC25C requires dissociation from 14-3-3 protein and phosphorylation in various sites within the N-terminal domain, such as Thr48, Thr67, Ser122, Thr130, and Ser214.Activated cyclin B1/CDK1 phosphorylates CDC25C at Thr48, Thr67, Thr138, Ser205, and Ser285 to activate it. |
|---|
| Bibliography | Liu K, Zheng M, Lu R, Du J, Zhao Q, Li Z, Li Y, Zhang S. The role of CDC25C in cell cycle regulation and clinical cancer therapy: a systematic review. Cancer Cell Int. 2020 Jun 3;20:213. doi: 10.1186/s12935-020-01304-w. PMID: 32518522; PMCID: PMC7268735. |
|---|
