Primary Information |
|---|
| BoMiProt ID | Bomi7187 |
|---|
| Protein Name | Mitotic-spindle organizing protein 2/Mitotic-spindle organizing protein associated with a ring of gamma-tubulin 2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A5PJV8 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001092674.1 |
|---|
| Aminoacid Length | 158 |
|---|
| Molecular Weight | 15891 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | MZT2/FAM128/ MOZART2 |
|---|
| Gene ID | 787548 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Microtubule organization |
|---|
| PTMs | Phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A5PJV8|MZT2_BOVIN Mitotic-spindle organizing protein 2 OS=Bos taurus OX=9913 GN=MZT2 PE=2 SV=1
MAAAGAGPGPGPGAPPGLEAALQKLALRRKKVLS*34AEEMELFELAQAAGGAMDPDVFKILV
DLLKLNVAPLAVFQMLKSMCAGQRVASDSQDPTAAPLPTPSVPETRGRNKGGGALGGGPA
LAERGGRDGPGQRMPRQPSASRLPKGGGPGRS*152PPRSGT
|
|---|
| Predicted Disorder Regions | 2 disordered segments; (1-49), (80-158) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Wieczorek M, Huang TL, Urnavicius L, Hsia KC, Kapoor TM. MZT Proteins Form Multi-Faceted Structural Modules in the γ-Tubulin Ring Complex. Cell Rep. 2020 Jun 30;31(13):107791. doi: 10.1016/j.celrep.2020.107791. PMID: 32610146; PMCID: PMC7416306. |
|---|
