Primary Information |
|---|
| BoMiProt ID | Bomi7163 |
|---|
| Protein Name | Mitogen-activated protein kinase 1/ERT1/Extracellular signal-regulated kinase 2/Mitogen-activated protein kinase 2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P46196 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_786987.1 |
|---|
| Aminoacid Length | 360 |
|---|
| Molecular Weight | 41376 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | MAPK1 |
|---|
| Gene ID | 327672 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Protein Function | MAPK1 is a member of the extracellular-signal regulated kinases (ERKs), playing roles in cell proliferation, differentiation, and development.This is mainly in response to growth factors, mitogens, and many environmental stresses. |
|---|
| Biochemical Properties | MAPK1 (also known as ERK2) is the second member in the ERK subfamily, which contains a highly conserved serine/threonine kinase domain.AbMAPK1 possesses two N-glycosylation sites, one S_TK catalytic domain, and a conserved His-Arg-Asp domain (HRD). In addition, a conservative glycine rich ATP-phosphate-binding loop and a threonine-x-tyrosine motif (TEY) important for the autophosphorylation is also found. |
|---|
| PTMs | N-Acetylation at Ala, Phosphorylation at Ser/Thr,Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P46196|MK01_BOVIN Mitogen-activated protein kinase 1 OS=Bos taurus OX=9913 GN=MAPK1 PE=2 SV=3
MAAAAAAGAGPEMVRGQVFDVGPRYTNLS*29YIGEGAYGMVCSAYDNVNKVRVAIKKISPFE
HQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQH
LSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDH
TGFLT*185EY*187VAT*190RWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHI
LGILGS*246PS*248QEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADS*284KALDLLDKMLTFNPHK
RIEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
|
|---|
| Predicted Disorder Regions | 1-12, |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylation on Ser-29 by SGK1 results in its activation by enhancing its interaction with MAP2K1/MEK1 and MAP2K2/MEK2. |
|---|
| Bibliography | 1.Perera NCN, Godahewa GI, Lee J. Mitogen-activated protein kinase 1 from disk abalone (Haliotis discus discus): Roles in early development and immunity-related transcriptional responses. Fish Shellfish Immunol. 2016 Dec;59:57-65. doi: 10.1016/j.fsi.2016.10.031. Epub 2016 Oct 17. PMID: 27765698. |
|---|
