Primary Information |
---|
BoMiProt ID | Bomi7137 |
---|
Protein Name | Mitochondrial 2-oxoglutarate/malate carrier protein/Solute carrier family 25 member 11 |
---|
Organism | Bos taurus |
---|
Uniprot ID | P22292 |
---|
Milk Fraction | Whey |
---|
Ref Sequence ID | NP_777096.1 |
---|
Aminoacid Length | 314 |
---|
Molecular Weight | 34172 |
---|
FASTA Sequence |
Download |
---|
Gene Name | SLC25A11/SLC20A4 |
---|
Gene ID | 282523 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | The transport of 2-oxoglutarate across the mitochondrial membrane is specifically limited to the 2-oxoglutarate-malate carrier (OMC) protein |
---|
Biochemical Properties | Although labeling of cytosolic glutamate does occur when there is little transport of NADH across the mitochondrial membrane, because of the reversible nature of OMC, efflux of 2-oxoglutarate from mitochondria via OMC is stimulated during the recruitment of net forward flux through the malate/aspartate shuttle |
---|
PTMs | Acetylation |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P22292|M2OM_BOVIN Mitochondrial 2-oxoglutarate/malate carrier protein OS=Bos taurus OX=9913 GN=SLC25A11 PE=1 SV=3
MAATAS*6PGASGMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVKNRMQLSGEGAKTRE
YKTSFHALISILRAEGLRGIYTGLSAGLLRQATYTTTRLGIY*102TVLFERLTGADGTPPGFL
LKAVIGMTAGATGAFVGTPAEVALIRMTADGRLPVDQRRGYKNVFNALFRIVQEEGVPTL
WRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCASMISGLVTTAASMPV
DIVKTRIQNMRMIDGKPEYKNGLDVLVKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL
EQMNKAYKRLFLSG
|
---|
Predicted Disorder Regions | (1-19) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Additional Comments | detection of glutamate labeling from intact systems, organs, and whole animals has often been interpreted directly as TCA cycle flux in isotope studies |
---|
Bibliography | 1.J. L. Griffin, J. M. O'Donnell, L. T. White, R. J. Hajjar and E. D. Lewandowski Am J Physiol Cell Physiol 279:1704-1709, 2000. 2. |