Primary Information |
|---|
| BoMiProt ID | Bomi7107 |
|---|
| Protein Name | MICOS complex subunit MIC25/Coiled-coil-helix-coiled-coil-helix domain-containing protein 6 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q32L35 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001069870.1 |
|---|
| Aminoacid Length | 236 |
|---|
| Molecular Weight | 26439 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CHCHD6/MIC25 |
|---|
| Gene ID | 615934 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | controlling mitochondrial cristae structures.critical for maintaining the mitochondrial cristae morphology, ATP production, and oxygen consumption. |
|---|
| Biochemical Properties | a coiled coil helix-coiled coil helix domain at its C-terminal end and predominantly localizes to mitochondrial inner membrane.contain hydrophobic transmembrane regions. contain hydrophobic transmembrane regions. |
|---|
| PTMs | Lipidation,Disulfide bond formation,N-myristoylation,Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q32L35|MIC25_BOVIN MICOS complex subunit MIC25 OS=Bos taurus OX=9913 GN=CHCHD6 PE=2 SV=1
MGSAESREGRRAS*13FGMDEEERVRVLQGIRLS*31ENVVNRMKEPGQPSRVGLLAPPAAALGPS
GGREKDSKPPRPDCGSGRGPPRVQVDPLERCDWEQAVLQDELVRVATTEREAAASPRSVT
LRRGEGGVDQEKQRLAQRARELESQEEELRCRDAFYKEQLGRLERQNLEAYRLSSQQFHE
AATKIEGAIKPRRVEPVCSGLQAQILRCYRDRLQEVLLCADLVRAYQHCVSSAHKG
|
|---|
| Predicted Disorder Regions | 1-141, 227-236 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | CHCHD6 depletion also leads to reductions in cell growth, ATP production, and oxygen consumption.through its C-terminal end strongly interacts with the mitochondrial inner membrane protein mitofilin, which is known to also control mitochondrial cristae morphology. |
|---|
| Bibliography | An J, Shi J, He Q, Lui K, Liu Y, Huang Y, Sheikh MS. CHCM1/CHCHD6, novel mitochondrial protein linked to regulation of mitofilin and mitochondrial cristae morphology. J Biol Chem. 2012 Mar 2;287(10):7411-26. doi: 10.1074/jbc.M111.277103. Epub 2012 Jan 6. PMID: 22228767; PMCID: PMC3293568. |
|---|
