Primary Information |
|---|
| BoMiProt ID | Bomi6974 |
|---|
| Protein Name | Matrix Gla protein |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P07507 |
|---|
| Milk Fraction | Whey,Casein |
|---|
| Ref Sequence ID | NP_777132.1 |
|---|
| Aminoacid Length | 103 |
|---|
| Molecular Weight | 12217 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | MGP |
|---|
| Gene ID | 282660 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | MGP is considered to be a marker of vitamin K status in bone and vasculature.Matrix Gla protein (MGP), belongs to the vitamin K dependent protein family, which is comprised of both hepatic and extrahepatic proteins.Associates with the organic matrix of bone and cartilage. Matrix Gla protein is a vitamin K-dependent protein secreted by chondrocytes and vascular smooth muscle cells. inhibitory role of physiological and ectopic calcification. |
|---|
| Biochemical Properties | 84 amino acid residues and 5 Gla(r γ-carboxyglutamic acid) residues.The activity is mainly due to the high affinity of their γ-carboxyglutamic acid
(Gla) residues for calcium ions. These residues are the result
of γ-carboxylation of glutamic acid, a reaction catalyzed
by γ-glutamyl carboxylase, in which vitamin K acts as a
cofactor.A phosphorylation domain, in the N-terminal end of the
signal peptide, contains 3 phosphorylated serine residues.A single, disulfide bond is observed between two conserved
cysteines.The
N-terminal end also includes the target site for γ-glutamyl
carboxylase. Bovine matrix Gla protein is of 79-residue long,contains a single disulfide bond and 4.8 gamma-carboxyglutamate (Gla) residues, one each at positions 37, 41, 48, and 52, and 0.8 Gla and 0.2 Glu at position 2. |
|---|
| Significance in milk | Bovine bone growth |
|---|
| PTMs | Disulfide bond.phosphorylation and γ-carboxylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P07507|MGP_BOVIN Matrix Gla protein OS=Bos taurus OX=9913 GN=MGP PE=1 SV=1
MKSLLLLSILAALAVAALCYES*22HES*25LES*28YEINPFINRRNANSFISPQQRWRAKAQERIRE
LNKPQYELNREACDDFKLCERYAMVYGYNAAYDRYFRQRRGAK
|
|---|
| Predicted Disorder Regions | 5 predicted disordered segments; (1-5), (31-49), (54-63), (85-87), (92-103) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | MGPs undergo reactions of phosphorylation and γ-carboxylation for the sole purpose of binding calcium ions and inhibiting calcification.There is Conserved phosphorylation of serines in the Ser-X-Glu/Ser(P) sequences of the vitamin K-dependent matrix Gla protein from shark, lamb, rat, cow, and human. |
|---|
| Additional Comments | Due to sequence homology,MGP and bone Gla protein (BGP) to indicate that these two bovine bone proteins arose by gene duplication and subsequent divergent evolution. Although MGP has a very low solubility in water compared to BGP, there is no hydrophobic domain in MGP which could account for its insolubility, and the overall fraction of hydrophobic residues is 32% for MGP compared to 43% for BGP. |
|---|
| Bibliography | 1.Price PA, Williamson MK. Primary structure of bovine matrix Gla protein, a new vitamin K-dependent bone protein. J Biol Chem. 1985 Dec 5;260(28):14971-5. PMID: 3877721. 2.Gheorghe SR, Crăciun AM. Matrix Gla protein in tumoral pathology. Clujul Med. 2016;89(3):319-21. doi: 10.15386/cjmed-579. Epub 2016 Jul 28. PMID: 27547048; PMCID: PMC4990424. 3.Price PA, Rice JS, Williamson MK. Conserved phosphorylation of serines in the Ser-X-Glu/Ser(P) sequences of the vitamin K-dependent matrix Gla protein from shark, lamb, rat, cow, and human. Protein Sci. 1994 May;3(5):822-30. doi: 10.1002/pro.5560030511. PMID: 8061611; PMCID: PMC2142713. |
|---|
