Primary Information |
|---|
| BoMiProt ID | Bomi6946 |
|---|
| Protein Name | Malignant T-cell-amplified sequence 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2KIE4 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001039468.1 |
|---|
| Aminoacid Length | 181 |
|---|
| Molecular Weight | 20555 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | MCTS1 |
|---|
| Gene ID | 508412 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | tongue muscle |
|---|
| Protein Function | The malignant T cell-amplified sequence 1 (MCT-1/MCTS1) oncoprotein support noncanonical translation initiation, promote translation reinitiation on a specific set of mRNAs with short upstream reading frames, and regulate ribosome recycling. |
|---|
| PTMs | Phosphorylation at Ser/Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2KIE4|MCTS1_BOVIN Malignant T-cell-amplified sequence 1 OS=Bos taurus OX=9913 GN=MCTS1 PE=2 SV=1
MFKKFDEKENVSNCIQLKTSVIKGIKNQLIEQFPGIEPWLNQIMPKKDPVKIVRCHEHIE
ILTVNGELLFFRQREGPFYPT*81LRLLHKYPFILPHQQVDKGAIKFVLSGANIMCPGLTS*118PG
AKLYPAAVDTIVAIMAEGKQHALCVGVMKMSAEDIEKVNKGIGIENIHYLNDGLWHMKTY
K
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Phosphorylation is critical for stabilization and promotion of cell proliferation. |
|---|
| Bibliography | 1.Lomakin IB, Dmitriev SE, Steitz TA. Crystal structure of the DENR-MCT-1 complex revealed zinc-binding site essential for heterodimer formation. Proc Natl Acad Sci U S A. 2019 Jan 8;116(2):528-533. doi: 10.1073/pnas.1809688116. Epub 2018 Dec 24. PMID: 30584092; PMCID: PMC6329987. 2. |
|---|
