Primary Information |
|---|
| BoMiProt ID | Bomi6914 |
|---|
| Protein Name | Lysozyme-like protein 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A0JNM6 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001071378.1 |
|---|
| Aminoacid Length | 148 |
|---|
| Molecular Weight | 16779 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | LYZL1 |
|---|
| Gene ID | 512087 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | lysozyme activity.antibacterial action of LYZL1 is involved bacterial membrane damage and leakage of cellular contents.role in male reproductive tract innate immunity. |
|---|
| Biochemical Properties | presence of α-helix, β-sheet and random coil with α-helix .possess peptidoglycan binding ability.Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan.The catalytic mechanism ofmlysozymes involves the interaction of Glu35 and Asp52 of the active site with beta-1,4 glycosidic bond of the substrate. |
|---|
| PTMs | Glycosylation and Disulfide bond addition |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A0JNM6|LYZL1_BOVIN Lysozyme-like protein 1 OS=Bos taurus OX=9913 GN=LYZL1 PE=2 SV=1
MKAAGILALMGCLVTVVEPKVYTRCKLAKIFSRASLDNYRGFSLGNWICMAYYESHYN*58TT
AQTQLEDGSTDYGIFQINSDTWCRSTKLQEKNRCHVACSALMTDDLTDAIICAKKIVKET
DGMNYWQGWKKNCEGRDLSEWKKGCEVS
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | no TM helices |
|---|
| Bibliography | Narmadha G, Yenugu S. In Silico and Biochemical Characterization of Lysozyme-Like Proteins in the Rat. PLoS One. 2016 Sep 9;11(9):e0161909. doi: 10.1371/journal.pone.0161909. PMID: 27611690; PMCID: PMC5017655. |
|---|
