Primary Information |
|---|
| BoMiProt ID | Bomi6886 |
|---|
| Protein Name | Lymphocyte antigen 96 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P58754 |
|---|
| Milk Fraction | Whey |
|---|
| Aminoacid Length | 160 |
|---|
| Molecular Weight | 18484 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | LY96 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Binds bacterial lipopolysaccharide (LPS).Cooperates with TLR4 in the innate immune response to bacterial lipopolysaccharide (LPS), and with TLR2 in the response to cell wall components from Gram-positive and Gram-negative bacteria. |
|---|
| Biochemical Properties | Heterogeneous homomer formed from homodimers; disulfide-linked .Belongs to the lipopolysaccharide (LPS) receptor, a multi-protein complex containing at least CD14, LY96 and TLR4. |
|---|
| PTMs | N linked Glycosylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P58754|LY96_BOVIN Lymphocyte antigen 96 OS=Bos taurus OX=9913 GN=LY96 PE=1 SV=1
MFPFMLFSTLFSSIFTEPREKMWICN*26SSDASLWYNYCDDMKFPISVKVEPCVTIKGTKGK
LHLYYIARRDIQKLYLNLHISIKSMTLPMRKEVICREYGGDYSFCGALKGETVN*114TTIPFS
FQGIRFSPGQYHCVVEAISGNSEEMLFCLN*150FTIIHYSSLN
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Sauter KS, Brcic M, Franchini M, Jungi TW. Stable transduction of bovine TLR4 and bovine MD-2 into LPS-nonresponsive cells and soluble CD14 promote the ability to respond to LPS. Vet Immunol Immunopathol. 2007 Jul 15;118(1-2):92-104. doi: 10.1016/j.vetimm.2007.04.017. Epub 2007 May 3. PMID: 17559944. |
|---|
