Primary Information |
|---|
| BoMiProt ID | Bomi6783 |
|---|
| Protein Name | Leukocyte surface antigen CD53/Cell surface glycoprotein CD53 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q58DM3 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001029404.1 |
|---|
| Aminoacid Length | 219 |
|---|
| Molecular Weight | 24103 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CD53 |
|---|
| Gene ID | 505040 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | blood |
|---|
| Protein Function | It is required for efficient formation of myofibers in regenerating muscle at the level of cell fusion. May be involved in growth regulation in hematopoietic cells |
|---|
| Biochemical Properties | The CD53 molecule is likely to consist of four transmembrane regions and a major extracellular hydrophilic loop containing two potential N-glycosylation sites. |
|---|
| PTMs | N-linked Glycosylation at Asn |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q58DM3|CD53_BOVIN Leukocyte surface antigen CD53 OS=Bos taurus OX=9913 GN=CD53 PE=2 SV=1
MGMSSLKLLKFVLFFFNLIFWFCGCCILGLGIYLLIHSKFGVLFHNLPSLTLGNVLVIVG
SVIMVVAFLGCMGSIKENKCLLMSFFVLLLIILLAEVTLAILLFVYEQKLKEYVAEGLTE
SIQRYNSDN*129STKAAWDSIQSFLQCCGVN*148GTSDWTSGPPASCPKGSAVKGCYIQAKQWFHS
NFLYIGITTICVCVIQVLGMSFALTLNCQIDKTSQVLGL
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 4TMHs; (13-35),(47-69),(82-104),(184-206) |
|---|
| Additional Comments | CD53 deficiency in humans has similarities to that of leukocyte adhesion deficiency patients, raising the possibility of a role for CD53 in immune cell adhesion and trafficking. |
|---|
| Bibliography | 1.Angelisová P, Vlcek C, Stefanová I, Lipoldová M, Horejsí V. The human leucocyte surface antigen CD53 is a protein structurally similar to the CD37 and MRC OX-44 antigens. Immunogenetics. 1990;32(4):281-5. doi: 10.1007/BF00187099. PMID: 1700763. 2.Yeung L, Anderson JML, Wee JL, Demaria MC, Finsterbusch M, Liu YS, Hall P, Smith BC, Dankers W, Elgass KD, Wicks IP, Kwok HF, Wright MD, Hickey MJ. Leukocyte Tetraspanin CD53 Restrains α3 Integrin Mobilization and Facilitates Cytoskeletal Remodeling and Transmigration in Mice. J Immunol. 2020 Jul 15;205(2):521-532. doi: 10.4049/jimmunol.1901054. Epub 2020 Jun 12. PMID: 32532837. |