Primary Information |
|---|
| BoMiProt ID | Bomi6494 |
|---|
| Protein Name | Interleukin-4/B-cell stimulatory factor 1/Lymphocyte stimulatory factor 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P30367 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_776346.1 |
|---|
| Aminoacid Length | 135 |
|---|
| Molecular Weight | 15119 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | IL4 |
|---|
| Gene ID | 280824 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | role in B-cell activation and maturation step.regulation of B cell growth and of antibody isotype expression. Stimulation of T cell growth and the generation of cytotoxic T lymphocytes.Regulation of the growth and differentiation of hematopoietic bone marrow stem cells. |
|---|
| Significance in milk | oncentration of IL-4 has been found significantly lower both in serum and in milk of cows with staphylococcal mastitis . |
|---|
| PTMs | Disulfide bond formation, Glycosylation,proteolytic cleavage. |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P30367|IL4_BOVIN Interleukin-4 OS=Bos taurus OX=9913 GN=IL4 PE=2 SV=2
MGLTSQLIPVLVCLLVCTSHFVHGHKCDITLAEIIKTLNILTTRKNSCMELPVADVFAAP
KN*62TTEKETFCRVGIELRRIYRSHTCLNKFLGGLDRNLNSLASKTCSVNEAKTSTSTLKDL
LERLKTIMKEKYSKC
|
|---|
| Predicted Disorder Regions | 125-135 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | no TM helices |
|---|
| Significance of PTMs | The protein contains two (human) or three (murine) N-glycosilation sites, yielding a glycoprotein with a molecular mass of 20 kD that is reduced to 15 kD after deglycosylation .Removal of the N-linked glycosidic side chains does not abrogate the bioactivity of the protein.A sequence encoding a hydrophobic stretch of peptide precedes the sequence coding for the mature protein. This putative signal peptide is cleaved from the protein before secretion. |
|---|
| Bibliography | 1.Bochniarz M, Zdzisińska B, Wawron W, Szczubiał M, Dąbrowski R. Milk and serum IL-4, IL-6, IL-10, and amyloid A concentrations in cows with subclinical mastitis caused by coagulase-negative staphylococci. J Dairy Sci. 2017 Dec;100(12):9674-9680. doi: 10.3168/jds.2017-13552. Epub 2017 Sep 28. PMID: 28964518. 2.Jansen JH, Fibbe WE, Willemze R, Kluin-Nelemans JC. Interleukin-4. A regulatory protein. Blut. 1990 May;60(5):269-74. doi: 10.1007/BF01736226. PMID: 2190652. |