Primary Information |
|---|
| BoMiProt ID | Bomi6492 |
|---|
| Protein Name | Interleukin-2 receptor subunit alpha/IL-2 receptor subunit alpha/IL-2-RA/IL-2R subunit alpha/IL2-RA/TAC antigen/p55/CD_antigen: CD25 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P12342 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_776783.1 |
|---|
| Aminoacid Length | 275 |
|---|
| Molecular Weight | 31239 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | IL2RA |
|---|
| Gene ID | 281861 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Receptor for interleukin-2.regulation of T cells.It acts as major growth factor for activated T-lymphocytes and stimulates clonal expansion and maturation of these lymphocytes. |
|---|
| Biochemical Properties | mouse IL2RA is 55kD.composed of N- and C-terminal fibronectin-III domains (D1 and D2, respectively), which are characterized by a β-sandwich sheet consisting of seven antiparallel strands arranged in a three-on-four topology. In IL-2Rβ, the D1 and D2 domains are connected by a helical linker and are bent at ∼90°.The two prominent hydrophobic ridges around residues Phe42 and Tyr45 of IL-2 insert into grooves between the IL-2Rα beta strands. |
|---|
| Significance in milk | involved in the intracellular signaling pathways |
|---|
| PTMs | Glycosylation and disulfide bond formation. |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P12342|IL2RA_BOVIN Interleukin-2 receptor subunit alpha OS=Bos taurus OX=9913 GN=IL2RA PE=2 SV=1
MEPSLLMWRFFVFIVVPGCVTEACHDDPPSLRNAMFKVFRYEVGTMINCDCKTGFRRVSA
VMRCVGDSSHSAWENRCFCN*80STSPAKNQVKQVTPAPEEHREKKHTDAQN*109QTQPPEEADLP
GHCEEPPPWEHEREPLKRVYHFTLGQTVHYQCAQGFRALQTSPAESTCMMINGELRWTRP
RLKCIREGEHGQASDDAEPQESTEAPPGSGTFLPTRMAGTTNFQKPTDEIATLDTFIFTT
EYQIAVAGCTLLLASILLLSCLTWQRKWKKNRRTI
|
|---|
| Predicted Disorder Regions | 82-137, 184-226 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH; (242-264) |
|---|
| Bibliography | 1.Kuhn DJ, Dou QP. The role of interleukin-2 receptor alpha in cancer. Front Biosci. 2005 May 1;10:1462-74. doi: 10.2741/1631. PMID: 15769637. 2.Wang X, Rickert M, Garcia KC. Structure of the quaternary complex of interleukin-2 with its alpha, beta, and gammac receptors. Science. 2005 Nov 18;310(5751):1159-63. doi: 10.1126/science.1117893. PMID: 16293754. |
|---|
