Primary Information |
|---|
| BoMiProt ID | Bomi6490 |
|---|
| Protein Name | Interleukin-12 subunit alpha |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P54349 |
|---|
| Milk Fraction | Whey,Casein |
|---|
| Ref Sequence ID | NP_776780.1 |
|---|
| Aminoacid Length | 155 |
|---|
| Molecular Weight | 15720 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | IL12A |
|---|
| Gene ID | 281856 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Induces interferon in natural
killer cells and T cells and, as such, may play a major
role in cell-mediated immunity.IL-12 is a natural killer cell stimulatory factor.An important factor for the differentiation of naive T cells into T-helper type 1 CD4+ lymphocytes secreting interferon-gamma ,T-cell-dependent immune and inflammatory responses. |
|---|
| Biochemical Properties | IL-12 is a glycosylated, 75 kDa heterodimeric cytokine
comprised of disulfide-bonded 35 kDa and 40 kDa
subunits. When it forms heterodimer with EBI3/IL27B without any disulfide-linked. This heterodimer is known as IL-35. |
|---|
| Significance in milk | a cytokine marker in Staphylococcus aureus mastitis of bovine mammary gland |
|---|
| PTMs | N linked Glycosylation on Asn |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P54349|IL12A_BOVIN Interleukin-12 subunit alpha OS=Bos taurus OX=9913 GN=IL12A PE=2 SV=1
MCPLRSLLLISTLVLLHHLPHLSLGRSLPTTTASPGRSCLDYSQNLLRAVSNTLQKARQT
LEFYSCTSEEIDHEDITKDKTSTVEACLPLELATN*95ESCLASRETSFITNGHCLASGKTSF
MTTLCLRSIYEDLKMYHVEFQAMNAKLLMDPKRQIFLDQNMLAAIAELMQALNFDSETVP
QKPSLKELDFYKTKVKLCILLHAFRIRAVTIDRMMSYLSSS
|
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Zarlenga DS, Canals A, Aschenbrenner RA, Gasbarre LC. Enzymatic amplification and molecular cloning of cDNA encoding the small and large subunits of bovine interleukin 12. Biochim Biophys Acta. 1995 Apr 24;1270(2-3):215-7. doi: 10.1016/0925-4439(95)00042-3. PMID: 7727547. |