Primary Information |
|---|
| BoMiProt ID | Bomi6464 |
|---|
| Protein Name | Interferon regulatory factor 3 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q4JF28 |
|---|
| Milk Fraction | Whey,MFGM |
|---|
| Ref Sequence ID | NP_001025016.1 |
|---|
| Aminoacid Length | 417 |
|---|
| Molecular Weight | 46646 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | IRF3 |
|---|
| Gene ID | 516979 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Interferon regulatory factor (IRF) 3 plays a key role in innate responses against viruses. Indeed, activation of this transcription factor triggers the expression of type I interferons and downstream interferon-stimulated genes in infected cells |
|---|
| Biochemical Properties | IRF3 was found to be a major component of the “MyD88-independent” pathway triggered downstream of TLR4 in response to lipopolysaccharide (LPS).C-terminal domain of IRF-3 located between aa 380 and 427 participates in the autoinhibition of IRF-3 activity via an intramolecular association with the N-terminal region between aa 98 and 240. |
|---|
| PTMs | Phosphorylation at Ser/Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q4JF28|IRF3_BOVIN Interferon regulatory factor 3 OS=Bos taurus OX=9913 GN=IRF3 PE=2 SV=1
MGT*3QKPRILPWLIS*14QLDRGELEGVAWLGESRTRFRIPWKHGLRQDAQQEDFGIFQAWAVA
SGAYT*75PGKDKPDLPTWKRNFRSALNRKEVLRLAEDHS*97KDSQDPHKIYEFVNSGVRDIPEP
DTS*123QDNGRHNTSDTQEDTLEKLLSDMDLSPGGPSNLTMASEKPPQFLQSPDSDIPALCPN
SGLS*184ENPLKQLLANEEDWEFEVTAFYRGCQVFQQTVFCPGGLRLVGSEAGDRMLPGQPIR
LPDPATSLT*249DKSVTDYVQRVLSCLGGGLALWRAGQWLCAQRLGHCHVYWAIGEELLPSCG
HKPDGEVPKDREGGVFNLGPFITDLITFIEGSRRSPLYTLWFCVGQSWPQDQPWIKRLVM
VKVVPMCLRVLVDIARQGGAS*381S*382LENTVDLHIS*392NS*394DPLSLT*400PDQYMACLQDLAEDMDF
|
|---|
| Predicted Disorder Regions | 66-77, 95-184, 237-245 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Carboxy-terminal phosphorylation of serine residues located in the regulatory domain of IRF3 allows
homo- and heterodimerization, nuclear translocation and
association with chromatin modifiers such as CREB-binding protein (CBP) and p300 to promote the transcription of
its target genes.Virus-induced phosphorylation of IRF-3 leads to cytoplasmic to nuclear translocation of phosphorylated IRF-3, association with the transcriptional coactivator CBP/p300, and stimulation of DNA binding and transcriptional activities of virus-inducible genes. |
|---|
| Bibliography | 1.Ysebrant de Lendonck L, Martinet V, Goriely S. Interferon regulatory factor 3 in adaptive immune responses. Cell Mol Life Sci. 2014 Oct;71(20):3873-83. doi: 10.1007/s00018-014-1653-9. Epub 2014 May 31. PMID: 24879293. |