Primary Information |
|---|
| BoMiProt ID | Bomi6389 |
|---|
| Protein Name | Inactive serine/threonine-protein kinase VRK3/Serine/threonine-protein pseudokinase VRK3/Vaccinia-related kinase 3 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2YDN8 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001039716.1 |
|---|
| Aminoacid Length | 451 |
|---|
| Molecular Weight | 50549 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | VRK3 |
|---|
| Gene ID | 520302 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | It is a direct activator of vaccinia H1-related (VHR) phosphatase, inactivates extracellular signal-regulated kinase (ERK) in the nucleus of neuronal cells.The kinase activity of VRK3 is involved in the regulation of the cell cycle. VRK3 expression levels increase during interphase, whereas VRK1 is enriched in late G2 and early M phase. |
|---|
| Biochemical Properties | is catalytically inactive due to changes in motifs that are essential for kinase activity.Has serine/threonine kinase activity,binds to DNA.VRK3 kinase activity is dependent upon its N-terminal regulatory region.VRK3 phosphorylates barrier-to-autointegration factor (BAF) on Ser4.VRK3 contains five potential cyclin-dependent kinase 5 (CDK5) phosphorylation sites, including the repeated motif (K/R)XSPQXT(K/R). |
|---|
| PTMs | Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2YDN8|VRK3_BOVIN Inactive serine/threonine-protein kinase VRK3 OS=Bos taurus OX=9913 GN=VRK3 PE=2 SV=1
MICPDCGKGIEATFKFCPYCGKPLPAEKHEGSQSFVKPFTSSSQGSRRKTNTS*53SETS*57SKK
VKWCSYAASPSLPLPSEGKS*80S*81GSEDTLS*88TSGKPKGHLSRSPTPRSSPQTTRQSPQTLKRS
RMTASLEALPVGTVLTDKSGQHWKLRCLQTRDDQGILYEAESDSTTGSESSPQKQRFSLK
LDAKDGRLFNEQNFFQRAAKPLQVNKWKKLYSIPQLAIPTCIGFGVHQDKYRFLVFPTLG
RSLQSILDDFPKHVMSVRSVFQMACRLLDALEFLHENEYVHGNVTAENIFVNPENLCQVT
LAGYGFTFRYSPGGRHVAYTEGSRSPHEGHLEFISMDLHKGCGPSRRSDLQTLGYCLLKW
LYGTLPWTNCLPNTEEIVKLKQKFLDNPEGLVGQCSRWITPSETLQEYLKVVMALQYEEK
PPYSTLRNELEALLQDLRASAYDPLDLQVVP |
|---|
| Predicted Disorder Regions | (20-130), (166-171) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | oxidative stress-induced cyclin-dependent kinase 5 (CDK5) activation stimulates neuroprotective signaling via phosphorylation of vaccinia-related kinase 3 (VRK3) at Ser 108.The binding of vaccinia H1-related (VHR) phosphatase to phosphorylated VRK3 increased its affinity for phospho-ERK and subsequently downregulated ERK activation. |
|---|
| Bibliography | 1.Park CH, Ryu HG, Kim SH, Lee D, Song H, Kim KT. Presumed pseudokinase VRK3 functions as a BAF kinase. Biochim Biophys Acta. 2015 Jul;1853(7):1738-48. doi: 10.1016/j.bbamcr.2015.04.007. Epub 2015 Apr 18. PMID: 25899223. 2.Kang TH, Kim KT. VRK3-mediated inactivation of ERK signaling in adult and embryonic rodent tissues. Biochim Biophys Acta. 2008 Jan;1783(1):49-58. doi: 10.1016/j.bbamcr.2007.10.011. Epub 2007 Nov 4. PMID: 18035061. 3.Song H, Kim W, Choi JH, Kim SH, Lee D, Park CH, Kim S, Kim DY, Kim KT. Stress-induced nuclear translocation of CDK5 suppresses neuronal death by downregulating ERK activation via VRK3 phosphorylation. Sci Rep. 2016 Jun 27;6:28634. doi: 10.1038/srep28634. PMID: 27346674; PMCID: PMC4922050. |