Primary Information |
---|
BoMiProt ID | Bomi6280 |
---|
Protein Name | Histone H1.2/CTL-1 |
---|
Organism | Bos taurus |
---|
Uniprot ID | P02253 |
---|
Milk Fraction | Whey,Casein,MFGM |
---|
Ref Sequence ID | NP_001076894.1 |
---|
Aminoacid Length | 213 |
---|
Molecular Weight | 21356 |
---|
FASTA Sequence |
Download |
---|
Gene Name | H1-2 |
---|
Gene ID | 513971 |
---|
Protein Existence Status | reviewed |
---|
Secondary Information |
---|
Protein Function | binds to linker DNA between nucleosomes forming the macromolecular structure known as the chromatin fiber. Histones H1 are necessary for the condensation of nucleosome chains into higher-order structured fibers. Acts also as a regulator of individual gene transcription through chromatin remodeling, nucleosome spacing and DNA methylation.Destabilization of linker histone H1.2 is essential for ATM activation and DNA damage repair |
---|
Biochemical Properties | The C-terminal domain is required for high-affinity binding to chromatin |
---|
PTMs | Acetylation, ADP-ribosylation, Citrullination, Hydroxylation, Methylation, Phosphoprotein |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P02253|H12_BOVIN Histone H1.2 OS=Bos taurus OX=9913 GN=H1-2 PE=1 SV=2
MS*2ETAPAAPAAAPPAEKTPVKKKAAKKPAGARRKASGPPVSELITKAVAASKERSGVSLA
ALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAATGEAKPKA
KKAGAAKPKKAAGAAKKTKKATGAAT*146PKKTAKKTPKKAKKPAAAAVTKKVAKSPKKAKAA
KPKKAAKSAAKAVKPKAAKPKVAKPKKAAPKKK |
---|
Predicted Disorder Regions | Completely predicted disordered protein; (1-213) |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Significance of PTMs | ADP-ribosylated on Ser-188 in response to DNA damage.During chromatin decondensation,Citrullination at Arg-54 (H1R54ci) by PADI4 takes place within the DNA-binding site of H1 and results in its displacement from chromatin. |
---|
Bibliography | Li, Z., Li, Y., Tang, M. et al. Destabilization of linker histone H1.2 is essential for ATM activation and DNA damage repair. Cell Res 28, 756–770 (2018). |