Primary Information |
|---|
| BoMiProt ID | Bomi6225 |
|---|
| Protein Name | Hepatocyte cell adhesion molecule/Protein hepaCAM |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A4FUY1 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001026929.2 |
|---|
| Aminoacid Length | 418 |
|---|
| Molecular Weight | 46057 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | HEPACAM |
|---|
| Gene ID | 521015 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | It associates with connexin 43 and enhances its localization in cellular junctions,Regulates Warburg Effect of Renal Cell Carcinoma via HIF-1α/NF-κB Signaling Pathway. |
|---|
| Biochemical Properties | hepaCAM associates with connexin 43, a main component of gap junctions, and enhances connexin 43 localization to the plasma membrane at cellular junctions. HepaCAM also increases the levels of connexin 43, not by enhancing its transcription but by stabilizing connexin 43 protein. |
|---|
| PTMs | Glycosylation at Asn and Phosphorylation at Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A4FUY1|HECAM_BOVIN Hepatocyte cell adhesion molecule OS=Bos taurus OX=9913 GN=HEPACAM PE=2 SV=1
MKREREAPSRAFSALRLAPFVYLLLIQTEPLEGVN*35ITSPVRLIHGTVGKAALLSVQYSST
SSDKPVVKWQLKRDKPVTVVQSIGTEVIGTLRPDYRDRIRLFENGSLLLSDLQLADEGTY
EVEISITDDTFTGEKTIN*138LTVDVPISRPQVLVASTTVLELSEAFTLN*167CSHENGTKPSYTW
LKDGKPLLN*189DSRMLLSPDQKVLTITRVLMEDDDLYSCVVENPISQGRSPPVKITVYRRSS
LYIILSTGGIFLLVTLVTVCACWKPSKKSGKKRKLEKQNS*280MEYMDQSDDRLKPEADTLPR
SGEQERKNPMALYILKDKDSPEPEENPASEPRSAAEPGPPGYSVSPAVPGRS*352PGLPIRSA
RRYPRSPARSPATGRTHSS*379PPRAPGSPGRSRSASRTLRTAGVHLIREQDEAGPVEISA |
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH; (241-263) |
|---|
| Additional Comments | Overexpression of HepaCAM inhibits bladder cancer cell proliferation and viability through the AKT/FoxO pathway. |
|---|
| Bibliography | 1.Wu M, Moh MC, Schwarz H. HepaCAM associates with connexin 43 and enhances its localization in cellular junctions. Sci Rep. 2016 Nov 7;6:36218. doi: 10.1038/srep36218. PMID: 27819278; PMCID: PMC5098153. 2.Fan Y, Ou L, Fan J, Li L, Wu X, Luo C, Gao Y, Niu L. HepaCAM Regulates Warburg Effect of Renal Cell Carcinoma via HIF-1α/NF-κB Signaling Pathway. Urology. 2019 May;127:61-67. doi: 10.1016/j.urology.2018.11.033. Epub 2018 Dec 4. PMID: 30528714. 3.Tang M, Zhao Y, Liu N, Chen E, Quan Z, Wu X, Luo C. Overexpression of HepaCAM inhibits bladder cancer cell proliferation and viability through the AKT/FoxO pathway. J Cancer Res Clin Oncol. 2017 May;143(5):793-805. doi: 10.1007/s00432-016-2333-y. Epub 2017 Feb 22. PMID: 28229220. |