Primary Information |
|---|
| BoMiProt ID | Bomi6202 |
|---|
| Protein Name | Heat shock factor protein 1/Heat shock transcription factor 1/
HSTF 1/HSF 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q08DJ8 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001070277.1 |
|---|
| Aminoacid Length | 525 |
|---|
| Molecular Weight | 56702 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | HSF1 |
|---|
| Gene ID | 506235 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Functions as a stress-inducible and DNA-binding transcription factor that plays a central role in the transcriptional activation of the heat shock response (HSR), leading to the expression of a large class of molecular chaperones heat shock proteins (HSPs) that protect cells from cellular insults' damage. |
|---|
| PTMs | Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q08DJ8|HSF1_BOVIN Heat shock factor protein 1 OS=Bos taurus OX=9913 GN=HSF1 PE=2 SV=1
MDLPVGPGAAGPSNVPAFLTKLWTLVSDPDTDALICWSPSGNSFHVLDQGQFAKEVLPKY
FKHSNMASFVRQLNMYGFRKVVHIEQGGLVKPERDDTEFQHPCFLRGQEQLLENIKRKVT
S*121VSTLRSEDIKIRQDSVTKLLT*142DVQLMKGKQESMDSKLLAMKHENEALWREVASLRQKHA
QQQKVVNKLIQFLISLVQSNRILGVKRKIPLMLNDGGPAHPMPKYGRQYS*230LEHIHGPGPY
PAPSPAYSGSSLYSPDAVTSSGPIISDITELAPGS*275PVASSGGSVDERPLSSS*292PLVRVKEE
PPS*303PPQS*307PRAEGAS*314PGRPS*319S*320MVET*324PLS*327PTTLIDSILRESEPTPVAS*346TTPLVDTGGRPPS*359PLPASAPEKCLSVACLDKTELSDHLDAMDSNLDNLQTMLTSHGFSVDTSTLLDLFS*415PSVTVPDMSLPDLDSSLASIQELLS*440PQEPPRPLEAEKSSPDSGKQLVHYTAQPLLLLDPGSVDVG
SSDLPVLFELGEGSYFSEGDDYSDDPTISLLTGSEPPKAKDPTVS |
|---|
| Predicted Disorder Regions | 10 predicted disordered segments; (4-10), (86-91), (125-127), (149-153), (254-256), (285-329), (346-358), (369-371), (400-410), (421-525) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Acetylated on Lys-118; this acetylation is decreased in a IER5-dependent manner. Acetylated on Lys-118, Lys-208 and Lys-298; these acetylations occur in a EP300-dependent manner. Acetylated on Lys-80; this acetylation inhibits DNA-binding activity upon heat shock. Deacetylated on Lys-80 by SIRT1; this deacetylation increases DNA-binding activity.Phosphorylated on Ser-415 by PLK1; phosphorylation promotes nuclear translocation upon heat shock.Phosphorylated on Thr-142; this phosphorylation increases HSF1 transactivation activity upon heat shock. |
|---|
