Primary Information |
|---|
| BoMiProt ID | Bomi6127 |
|---|
| Protein Name | Growth arrest and DNA damage-inducible protein GADD45 alpha |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3ZBN6 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001029419.1 |
|---|
| Aminoacid Length | 165 |
|---|
| Molecular Weight | 18337 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | GADD45A |
|---|
| Gene ID | 505463 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | GADD45A is an epigenetic R-loop reader that recruits the demethylation machinery to promoter CGIs.. Binds directly to R-loops and mediates local DNA demethylation by recruiting TET1 (ten-eleven translocation 1).R-loops are DNA-RNA hybrids enriched at CpG islands (CGIs) that can regulate chromatin states. |
|---|
| PTMs | Phosphorylation on Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3ZBN6|GA45A_BOVIN Growth arrest and DNA damage-inducible protein GADD45 alpha OS=Bos taurus OX=9913 GN=GADD45A PE=2 SV=1
MT*2LEEFSAGEQKTERMDKVGDALEEVLSKALSQRTITVGVYEAAKLLNVDPDNVVLCLLA
ADEDDDRDVALQIHFTLIQAFCCENDIDILRVSNPGRLAELLLLETDAGPAASEGAEQPP
DLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER |
|---|
| Predicted Disorder Regions | 1-19, 108-119 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Arab K, Karaulanov E, Musheev M, Trnka P, Schäfer A, Grummt I, Niehrs C. GADD45A binds R-loops and recruits TET1 to CpG island promoters. Nat Genet. 2019 Feb;51(2):217-223. doi: 10.1038/s41588-018-0306-6. Epub 2019 Jan 7. PMID: 30617255; PMCID: PMC6420098. |
|---|
