Primary Information |
|---|
| BoMiProt ID | Bomi6103 |
|---|
| Protein Name | GPN-loop GTPase 1/XPA-binding protein 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A4FUD1 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001076861.1 |
|---|
| Aminoacid Length | 373 |
|---|
| Molecular Weight | 41450 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | GPN1/XAB1 |
|---|
| Gene ID | 508522 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | GTPase,cell growth in eukaryotes,microtubule assembly in nuclear part. |
|---|
| Biochemical Properties | contains a unique and highly conserved GPN loop motif for activity and for nuclear localization of POLR2A/RPB1. |
|---|
| PTMs | Acetylation,Phosphorylation on Ser and Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A4FUD1|GPN1_BOVIN GPN-loop GTPase 1 OS=Bos taurus OX=9913 GN=GPN1 PE=2 SV=1
MAAPASATESQASGGPRPPACLLVLGMAGSGKTTFVQRLTGYLHSQGCPPYVINLDPAVH
EVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKYVL
IDTPGQIEVFTWSASGTIITEALASSFPTIVIYVMDTSRSTNPVTFMSNMLYACSILYKT
KLPFIVVMNKTDIIDHSFAVEWMQDFEAFQDALNQETTYVSNLTRSMSLVLDEFYSSLRV
VGVSAVLGTGLDELFVQVASATEEYEREYRPEYERLKKSLASAQSQQQKEQLERLQKDMG
S*301VALDTGTATGS*312SS*314PVLDPSDLILTRGT*328LDEEDEEADS*338DT*340DDIDHRVTEESREEPAFQNFMQESMAQYWKKNK |
|---|
| Predicted Disorder Regions | 1-16, 271-373 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Forget D, Lacombe AA, Cloutier P, Al-Khoury R, Bouchard A, Lavallée-Adam M, Faubert D, Jeronimo C, Blanchette M, Coulombe B. The protein interaction network of the human transcription machinery reveals a role for the conserved GTPase RPAP4/GPN1 and microtubule assembly in nuclear import and biogenesis of RNA polymerase II. Mol Cell Proteomics. 2010 Dec;9(12):2827-39. doi: 10.1074/mcp.M110.003616. Epub 2010 Sep 20. PMID: 20855544; PMCID: PMC3002788. |
|---|
