Primary Information |
|---|
| BoMiProt ID | Bomi6091 |
|---|
| Protein Name | Golgi-resident adenosine 3',5'-bisphosphate 3'-phosphatase |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2KJ53 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001039800.1 |
|---|
| Aminoacid Length | 362 |
|---|
| Molecular Weight | 38924 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | BPNT2 |
|---|
| Gene ID | 532797 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | This protein may play a role in the formation of skeletal elements derived through endochondral ossification,by clearing adenosine 3',5'-bisphosphate produced by Golgi sulfotransferases during glycosaminoglycan sulfation. |
|---|
| Biochemical Properties | BPNT2 catalyzes the breakdown of 3'-phosphoadenosine-5'-phosphate, a by-product of glycosaminoglycan (GAG) sulfation. |
|---|
| PTMs | Acetylation and N-linked Glycosylation at Asn,Autophosphorylation at various serine and threonine residues. |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2KJ53|IMPA3_BOVIN Golgi-resident adenosine 3',5'-bisphosphate 3'-phosphatase OS=Bos taurus OX=9913 GN=BPNT2 PE=2 SV=1
MAPMGIRLSPLGVAVFCLLGLGVLYHLYSGFLAGRFSLFGLGGEPGGGAAGPAGPAASAD
GGTVDLREMLAVSVLAAVRGGEEVRRVRESNVLHEKSKGKTREGADDKMTSGDVLSNRKM
FYLLKTAFPSVQINTEEHVDASDQEVILWDRKIPEDILKEIATPQEVPAESVTVWIDPLD
ATQEYTEDLRKYVTTMVCVAVNGKPVLGVIHKPFSEYTAWAMVDGGSNVKARTSYNEKTP
RIVVSRSHSGMVKQVALQTFGN*262QTTIIPAGGAGYKVLALLDVPDKSQEKADLYIHVTYIK
KWDICAGNAILKALGGHMTTLSGEEISYTGSDGIEGGLLASIRMNHQALVRKLPDLEKTG
HK |
|---|
| Predicted Disorder Regions | 45-58, 91-106, 162-166, 354-362 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 1TMH; (11-33) |
|---|
| Significance of PTMs | Autophosphorylation does not impair its ability to phosphorylate p53/TP53. Phosphorylation by PLK3 leads to induction of Golgi fragmentation during mitosis |
|---|
| Additional Comments | BPNT2, a known target of lithium, is important for glycosaminoglycan sulfation in the brain, suggesting that lithium-mediated inhibition of BPNT2 in the nervous system warrants further investigation. |
|---|
| Bibliography | 1.Eisele BS, Wu AJ, Luka Z, Hale AT, York JD. Bisphosphate nucleotidase 2 (BPNT2), a molecular target of lithium, regulates chondroitin sulfation patterns in the cerebral cortex and hippocampus. Adv Biol Regul. 2021 Dec 9:100858. doi: 10.1016/j.jbior.2021.100858. Epub ahead of print. PMID: 34920982. 2.Eisele BS, Luka Z, Wu AJ, Yang F, Hale AT, York JD. Sulfation of glycosaminoglycans depends on the catalytic activity of lithium-inhibited phosphatase BPNT2 in vitro. J Biol Chem. 2021 Nov;297(5):101293. doi: 10.1016/j.jbc.2021.101293. Epub 2021 Oct 8. PMID: 34634304; PMCID: PMC8551643. |
|---|
