Primary Information |
|---|
| BoMiProt ID | Bomi6036 |
|---|
| Protein Name | Glutamine synthetase/Glutamate--ammonia ligase/Palmitoyltransferase GLUL |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P15103 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001035564.1 |
|---|
| Aminoacid Length | 373 |
|---|
| Molecular Weight | 42031 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | GLUL |
|---|
| Gene ID | 281199 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | prefrontal cortex |
|---|
| Protein Function | Glutamine synthetase assimilates ammonium into amino acids, thus it is a key enzyme for nitrogen metabolism.The cytosolic isoenzymes of glutamine synthetase assimilate ammonium derived from primary nitrogen uptake and from various internal nitrogen recycling pathways. |
|---|
| Biochemical Properties | Some key domains of the GS protein are ATP-binding and glutamate-binding sites. |
|---|
| PTMs | N-Acetylation at Ala,Palmitoylation, Phosphorylation at Ser/tyr, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P15103|GLNA_BOVIN Glutamine synthetase OS=Bos taurus OX=9913 GN=GLUL PE=2 SV=4
MATSASSHLNKGIKQVYMALPQGDKVQAMYIWIDGTGEGLRCKTRTLDSEPKCIEELPEW
NFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKY*104NRKPAETNLRHTCKRI
MDMVSNQRPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADKAYGRDIVEAHY
RACLYAGIKIGGTNAEVMPAQWEFQIGPCEGIDMGDHLWVARFILHRVCEDFGVIATFDP
KPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRL
TGFHETSNINDFSAGVANRGASIRIPRTVGQEKKGYFEDRRPS*343ANCDPFAVTEALIRTCL
LNETGDEPFQYKN |
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | GS1 activity may be downregulated via a chain of processes elicited by metabolic imbalances and environmental constraints. |
|---|
| Bibliography | 1.Bernard SM, Habash DZ. The importance of cytosolic glutamine synthetase in nitrogen assimilation and recycling. New Phytol. 2009;182(3):608-620. doi: 10.1111/j.1469-8137.2009.02823.x. PMID: 19422547. 2.Thomsen HC, Eriksson D, Møller IS, Schjoerring JK. Cytosolic glutamine synthetase: a target for improvement of crop nitrogen use efficiency? Trends Plant Sci. 2014 Oct;19(10):656-63. doi: 10.1016/j.tplants.2014.06.002. Epub 2014 Jul 10. PMID: 25017701. |
|---|
