Primary Information |
|---|
| BoMiProt ID | Bomi5975 |
|---|
| Protein Name | General transcription factor IIF subunit 2/ATP-dependent helicase GTF2F2/Transcription initiation factor IIF subunit beta/TFIIF-beta |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2T9L9 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001033153.1 |
|---|
| Aminoacid Length | 249 |
|---|
| Molecular Weight | 28446 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | GTF2F2 |
|---|
| Gene ID | 509259 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | intiation factor of transcription that binds to RNA polymerase II.required for promoter escape by RNA polymerase II.TFIIF stabilizes binding of pol II to TFIID and TFIIB at the promoter. |
|---|
| Biochemical Properties | TFIIF is an αβ hetero-oligomer of RAP74 and RAP30 subunits.RNA polymerase II binds first to the RAP30 subunit of TFIIF |
|---|
| PTMs | SUMOylation,Acetylation on Lys and Ala and phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2T9L9|T2FB_BOVIN General transcription factor IIF subunit 2 OS=Bos taurus OX=9913 GN=GTF2F2 PE=2 SV=1
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKAPGRGEVGKLRIAKNQGRTEVSFTLNE
DLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA
NENYMRLKRLQIEESSKPVRLS*142QQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVSYLKDILKEIGVQNVKGIHKNTWELKPEYR
HYQVEEKS*248D |
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | TFIIF is a major target of sumoylation, specifically at lysines 60/61 of its Tfg1 subunit, and elevating Tfg1 sumoylation resulted in decreased interaction of TFIIF with RNAPII. On the other hand, reducing promoter-associated sumoylation, by mutating SUMO-modified residues on Tfg1, also reduced RNAPII occupancy levels. Thus dynamic sumoylation of promoter-bound GTFs, not merely the presence or absence of SUMO, is important for facilitating rearrangements of promoter-bound TFIIF that enhance transcription. |
|---|
| Bibliography | 1.Kamada K, De Angelis J, Roeder RG, Burley SK. Crystal structure of the C-terminal domain of the RAP74 subunit of human transcription factor IIF. Proc Natl Acad Sci U S A. 2001 Mar 13;98(6):3115-20. doi: 10.1073/pnas.051631098. PMID: 11248041; PMCID: PMC30616. 2.Chang C, Kostrub CF, Burton ZF. RAP30/74 (transcription factor IIF) is required for promoter escape by RNA polymerase II. J Biol Chem. 1993 Sep 25;268(27):20482-9. PMID: 8376403. 3.Baig MS, Dou Y, Bergey BG, Bahar R, Burgener JM, Moallem M, McNeil JB, Akhter A, Burke GL, Sri Theivakadadcham VS, Richard P, D'Amours D, Rosonina E. Dynamic sumoylation of promoter-bound general transcription factors facilitates transcription by RNA polymerase II. PLoS Genet. 2021 Sep 29;17(9):e1009828. doi: 10.1371/journal.pgen.1009828. PMID: 34587155; PMCID: PMC8505008. |