Primary Information |
|---|
| BoMiProt ID | Bomi5974 |
|---|
| Protein Name | General transcription factor IIF subunit 1/Transcription initiation factor IIF subunit alpha/TFIIF-alpha |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q5EA53 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001015527.1 |
|---|
| Aminoacid Length | 517 |
|---|
| Molecular Weight | 58262 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | GTF2F1 |
|---|
| Gene ID | 505702 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Negative DNA supercoiling partially compensates for the defects of TFIIF mutants in initiation, indicating that TFIIF may help to untwist the DNA helix for initiation. |
|---|
| Biochemical Properties | Single amino acid substitutions at hydrophobic residues L155, W164, I176, and M177 have similar activity to RAP74(1-158). |
|---|
| PTMs | N6-Acetylation at Lys, Phosphorylation at Ser/Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q5EA53|T2FA_BOVIN General transcription factor IIF subunit 1 OS=Bos taurus OX=9913 GN=GTF2F1 PE=2 SV=1
MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNLTTWNQARLERDLSNKKIYQEE
EMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTE
NTSYYIFTQCPDGAFEAFPVHNWYNFTPLAKHRTLT*156AEEAEEEWERRNKVLNHFSIMQQR
RLKDQDQDEEDEEKEKRSRKKASELRIHDLEDDLEMS*217S*218DDS*221EAS*224GEEGGRAPKAKKKAPPSKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQDELEGKPKATQQEEGPKG
VDEQSESSEESEEEKPPEEDKEEEEEKKAPT*331PQEKKRRKDSSEESDSSEESDIDSEASSALFMAKKKTPPKRERKPS*377GGS*380S*381RGNS*385RPGT*389PS*391TEAGSTSSTLRAAASKLEQGKRTSETPAAKRLRLDTGPQS*431LS*433GKS*436T*437PQPQSGKST*446PSS*449GDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE
|
|---|
| Predicted Disorder Regions | 3-14, 57-76, 107-114, 154-481 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | Mutagenic analysis shows that the N-terminal region of RAP74 between L155 (leucine at codon 155) and M177 is important for initiation. Mutants in this region have reduced activity in transcription, but none are inactive. |
|---|
| Bibliography | 1.Ren D, Lei L, Burton ZF. A region within the RAP74 subunit of human transcription factor IIF is critical for initiation but dispensable for complex assembly. Mol Cell Biol. 1999 Nov;19(11):7377-87. doi: 10.1128/MCB.19.11.7377. PMID: 10523626; PMCID: PMC84731. 2.Ren D, Lei L, Burton ZF. A region within the RAP74 subunit of human transcription factor IIF is critical for initiation but dispensable for complex assembly. Mol Cell Biol. 1999 Nov;19(11):7377-87. doi: 10.1128/MCB.19.11.7377. PMID: 10523626; PMCID: PMC84731. |
|---|
