Primary Information |
|---|
| BoMiProt ID | Bomi5945 |
|---|
| Protein Name | Gastrin/cholecystokinin type B receptor/CCK-B receptor/CCK-BR/Cholecystokinin-2 receptor/CCK2-R |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P79266 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_776687.2 |
|---|
| Aminoacid Length | 454 |
|---|
| Molecular Weight | 48781 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | CCKBR |
|---|
| Gene ID | 281665 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Receptor for gastrin and cholecystokinin. modulate anxiety, analgesia, arousal, and neuroleptic activity.found in CNS and also in GI tract mainly in parietal cells,Proximal tubules and collecting ducts of kidney. Regulation of sodium-H+ ATPase activity. also known as CCK2 receptor (CCK2R) |
|---|
| Biochemical Properties | Kd values for high- and low-affinity binding of CCK to CCK2R are ∼100–300 pM and 2–5 nM, respectively.The two natural ligands with the highest affinities for CCK2R are sulfated gastrin-17 (often abbreviated G-17II) and sulfated CCK-8.due to the abundance of sulfated CCK-8 in the central nervous system, it is likely the ligand which naturally activates brain CCK2R.contains NPXXY motif which is imp for activation of phospholipase C. Asn of this motif is essential for G protein activation.E/DRY motif is to regulate cell proliferation.Transmembrane residues of the CCK2R such as Asp of TM II, triple basic motif (KKR) at the COOH terminus of the third intracellular loop, and a Phe residue of TM VI were shown to play a key role in the coupling of CCK2R to phospholipase C. |
|---|
| Significance in milk | During suckling,the level of gastrin increases ,which prepare the animal for increased food intake needed during lactation by increasing the size of the gastrointestinal tract. |
|---|
| PTMs | Glycosylation,Palmitoylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P79266|GASR_BOVIN Gastrin/cholecystokinin type B receptor OS=Bos taurus OX=9913 GN=CCKBR PE=2 SV=1
MELLKPN*7RSVLGSGPGPGASLCRSGGPLLN*30GSGTGN*36LSCEPPRIRGAGTRELELAIRVTL
YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVVCKAVSYFMGVSVSVSTLSLVAIALERYSAICRPLQARVWQTRSHAARVIVATWM
LSGLLMVPYPVYTAVQPAGPRVLQCMHRWPSARVRQTWSVLLLLLLFFVPGVVMAVAYGL
ISRELYLGLRFDGDSDSESQSRVGSQGGLPGGTGQGPAQANGRCRSETRLAGEDGDGCYV
QLPRSRPALEMSALTAPTPGPGSGTRPAQAKLLAKKRVVRMLLVIVVLFFLCWLPVYSAN
TWRAFDGPGAHRALSGAPISFIHLLTYASACVNPLVYCFMHRRFRQACLDTCTRCCPRPP
RARPRPLPDEDPPTPSIASLSRLSYTTISTLGPG
|
|---|
| Predicted Disorder Regions | 1-44, 259-297, 309-332, 422-441, 451-453 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | 7TMHs; (58-80), (91-113), (132-150), (171-193), (219-241), (341-359), (374-396) |
|---|
| Significance of PTMs | GPCR-mediated internalization is due to phosphorylation in the cterminus region of the proteins, that contributes both to the agonist response and to its desensitization. |
|---|
| Bibliography | 1.Pohl M, Silvente-Poirot S, Pisegna JR, Tarasova NI, Wank SA. Ligand-induced internalization of cholecystokinin receptors. Demonstration of the importance of the carboxyl terminus for ligand-induced internalization of the rat cholecystokinin type B receptor but not the type A receptor. J Biol Chem. 1997 Jul 18;272(29):18179-84. doi: 10.1074/jbc.272.29.18179. PMID: 9218453; PMCID: PMC6721839. 2.de Weerth A, Jonas L, Schade R, Schöneberg T, Wolf G, Pace A, Kirchhoff F, Schulz M, Heinig T, Greten H, von Schrenck T. Gastrin/cholecystokinin type B receptors in the kidney: molecular, pharmacological, functional characterization, and localization. Eur J Clin Invest. 1998 Jul;28(7):592-601. doi: 10.1046/j.1365-2362.1998.00310.x. PMID: 9726041. 3.Dufresne M, Seva C, Fourmy D. Cholecystokinin and gastrin receptors. Physiol Rev. 2006 Jul;86(3):805-47. doi: 10.1152/physrev.00014.2005. PMID: 16816139. 4.Svennersten K, Nelson L, Arvinder K, Uvnäs-Moberg K. Milking and feeding-induced release of the gastrointestinal hormones gastrin and somatostatin in dairy cows. J Dairy Sci. 1989 Sep;72(9):2276-82. doi: 10.3168/jds.S0022-0302(89)79358-9. PMID: 2574201. |
|---|
