Primary Information |
|---|
| BoMiProt ID | Bomi5933 |
|---|
| Protein Name | Gamma-glutamylcyclotransferase |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q32LE4 |
|---|
| Milk Fraction | Whey,MFGM |
|---|
| Ref Sequence ID | NP_001032699.1 |
|---|
| Aminoacid Length | 188 |
|---|
| Molecular Weight | 21177 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | GGCT |
|---|
| Gene ID | 533374 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | is involved in glutathione (GSH) degradation and involved in aminoacid transport through plasma membrane. |
|---|
| Biochemical Properties | Catalyzes the formation of 5-oxoproline from gamma-glutamyl dipeptides and may play a significant role in glutathione homeostasis., extracellular GSH can be hydrolysed by membrane-bound c-glutamyl transpeptidase (GGT) to cysteinyl-glycine and c-glutamyl–amino acid dipeptide.L cysteine is the acceptor for GGT. |
|---|
| Significance in milk | glutathione metabolism |
|---|
| PTMs | Phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q32LE4|GGCT_BOVIN Gamma-glutamylcyclotransferase OS=Bos taurus OX=9913 GN=GGCT PE=2 SV=1
MANFGCEDLRSQDGESFLYFAYGSNLLTERIHLRNPSAVFYSVARLQDFKLDFGNPQGKT
SETWHGGIATIFESPGDEVWGVVWKMNKSNLSSLDKQEGVKSGMYVPIEVTVSTQEGKEI
TCRSYQMTNYESVPPSPQYKKVICMGAKENGLPLEYQKKLNSIEPNDYKGKVS*173EEIEDII
KKGEAKTH |
|---|
| Predicted Disorder Regions | 1-10, 155-158, 164-188 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | He Z, Sun X, Wang S, Bai D, Zhao X, Han Y, Hao P, Liu XS. Ggct (γ-glutamyl cyclotransferase) plays an important role in erythrocyte antioxidant defense and red blood cell survival. Br J Haematol. 2021 Oct;195(2):267-275. doi: 10.1111/bjh.17775. Epub 2021 Aug 18. PMID: 34409610. |
|---|
