Primary Information |
|---|
| BoMiProt ID | Bomi5882 |
|---|
| Protein Name | G patch domain-containing protein 4 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q2KJE1 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001071597.1 |
|---|
| Aminoacid Length | 408 |
|---|
| Molecular Weight | 46797 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | GPATCH4/GPATC4 |
|---|
| Gene ID | 768314 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | G4 localizes to both the nucleolus and the Cajal body. involved in the regulation of cell growth and nucleolar structure. |
|---|
| Biochemical Properties | contains a RNA binding motif,a G pathch domain which is imp for its localization in nucleolus and rRNA association.. The C-terminal region between amino acids 300 and 446 also contains many lysines and arginines. These basic amino acids contribute to the nucleolar localization of G4. |
|---|
| PTMs | Acetylation, Isopeptide bond, Phosphorylation, Ubl conjugation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q2KJE1|GPTC4_BOVIN G patch domain-containing protein 4 OS=Bos taurus OX=9913 GN=GPATCH4 PE=2 SV=1
MSIT*4PEVKSRGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTYGVGHDPAKEF
TNHWWNDLFNKTAANLVVETRQDGVQIRRLSKETTRQDHAKPNLLYQKFVKTATLT*116SSGE
KPDKDWES*128CS*130DDDSQEPKPPNVLTDEMLLQACEGRTAHKAARLGITMKAKLARLEAQEQA
FLAQLKGQDPGVPQLQSESKSPKKKKKKRKQKEEEEPTTTERSAEKYSEHTDESIRKSKK
KKRQHQEERVTDEREGTAIENEEETIRTGGLGELKNREHVDRSFRKKKRRGQHHEERAEL
AVLDNEGGKVAVSEVGTEEAERRVYTHPCGRSKKRRQHEEEDLNTEDEEVEEALVDSGTR
EAESRSCSDQKRGRSKKKRRQYQEEEVLDGPGVNTAQKAKKKKQKKRD |
|---|
| Predicted Disorder Regions | 3-59, 88-408 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | G4 knockdown also decreased the number of fibrillar center and dense fibrillar component regions inside the nucleolus. |
|---|
| Bibliography | 1.Hirawake-Mogi H, Thanh Nhan NT, Okuwaki M. G-patch domain-containing protein 4 localizes to both the nucleoli and Cajal bodies and regulates cell growth and nucleolar structure. Biochem Biophys Res Commun. 2021 Jun 25;559:99-105. doi: 10.1016/j.bbrc.2021.04.026. Epub 2021 Apr 30. PMID: 33933995. 2.Hirawake-Mogi H, Thanh Nhan NT, Okuwaki M. G-patch domain-containing protein 4 localizes to both the nucleoli and Cajal bodies and regulates cell growth and nucleolar structure. Biochem Biophys Res Commun. 2021 Jun 25;559:99-105. doi: 10.1016/j.bbrc.2021.04.026. Epub 2021 Apr 30. PMID: 33933995. |
|---|
