Primary Information |
|---|
| BoMiProt ID | Bomi5835 |
|---|
| Protein Name | Forkhead box protein L2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q6VFT7 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001026920.1 |
|---|
| Aminoacid Length | 377 |
|---|
| Molecular Weight | 38887 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | FOXL2 |
|---|
| Gene ID | 281770 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Plays imp role as transcriptional regulator in gonadal sex differentiation. Critical factor essential for ovary differentiation and function, and repression of the genetic program for somatic testis determination.endometrial FOXL2 is, as a direct target of progesterone, involved in early pregnancy and implantation. |
|---|
| Significance in milk | FOXL2 is involved in the regulation of endometrial tissue physiology. |
|---|
| PTMs | Sumoylated with SUMO1.Phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q6VFT7|FOXL2_BOVIN Forkhead box protein L2 OS=Bos taurus OX=9913 GN=FOXL2 PE=2 SV=1
MMASYPEPENASGALLAPETGRAAKEPEAPPPPS*34PGKGGGGGTGTAPEKPDPAQKPPYSY
VALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREG
GGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGAGGAAGGCGVA
GAGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQMAAAAAAAAAAAAAAGPGSP
GAAAVVKGLAGPAASYGPYSRVQSMALPPGVVNSYNGLGGPPAAPPPPPHPHSHPHAHHL
HAAAAPPPAPPHHGAAAPPPGQLSPASPATAAPPAPAPTNAPGLQFACARQPELAMMHCS
YWDHDSKTGALHSRLDL |
|---|
| Predicted Disorder Regions | 4 disordered segments; (3-55), (228-245), (272-284), (366-376) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | sumoylation is required for transcriptional repression activity |
|---|
| Bibliography | Eozenou C, Lesage-Padilla A, Mauffré V, Healey GD, Camous S, Bolifraud P, Giraud-Delville C, Vaiman D, Shimizu T, Miyamoto A, Sheldon IM, Constant F, Pannetier M, Sandra O. FOXL2 is a Progesterone Target Gene in the Endometrium of Ruminants. Int J Mol Sci. 2020 Feb 21;21(4):1478. doi: 10.3390/ijms21041478. PMID: 32098259; PMCID: PMC7073057. |