Primary Information |
|---|
| BoMiProt ID | Bomi5817 |
|---|
| Protein Name | Follitropin subunit beta/Follicle-stimulating hormone beta subunit/Follitropin beta chain |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | P04837 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_776485.1 |
|---|
| Aminoacid Length | 129 |
|---|
| Molecular Weight | 14713 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | FSHB |
|---|
| Gene ID | 281171 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | adenohypophysis |
|---|
| Protein Function | FSHβ may promote BMP9-induced activation of BMP/Smad signaling through a FSH/FSH receptor (FSHR)/cAMP dependent pathway. |
|---|
| Biochemical Properties | FSH beta-subunit has multiple binding regions important for specific recognition by its receptor.N-terminus residues 9-30, in the extracellular domain of the follicle-stimulating hormone (FSH) receptor capable of binding FSH, but not luteinizing hormone (LH) or thyroid-stimulating hormone (TSH).The bullfrog FSH beta-subunit has approximately 60% sequence identity with that of mammals and 40% with the fish gonadotropin beta-subunit. |
|---|
| PTMs | Disulfide bond formation,N-linked glycosylation at Asn |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|P04837|FSHB_BOVIN Follitropin subunit beta OS=Bos taurus OX=9913 GN=FSHB PE=2 SV=1
MKSVQFCFLFCCWRAICCRSCELTN*25ITITVEKEECGFCISIN*42TTWCAGYCYTRDLVYRDP
ARPNIQKTCTFKELVYETVKVPGCAHHADSLYTYPVATECHCSKCDSDSTDCTVRGLGPS
YCSFREIKE |
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | 1.Hayashi T, Hanaoka Y, Hayashi H. The complete amino acid sequence of the follitropin beta-subunit of the bullfrog, Rana catesbeiana. Gen Comp Endocrinol. 1992 Oct;88(1):144-50. doi: 10.1016/0016-6480(92)90203-v. PMID: 1426958. 2.Hayashi T, Hanaoka Y, Hayashi H. The complete amino acid sequence of the follitropin beta-subunit of the bullfrog, Rana catesbeiana. Gen Comp Endocrinol. 1992 Oct;88(1):144-50. doi: 10.1016/0016-6480(92)90203-v. PMID: 1426958. 3.Su XY, Zou X, Chen QZ, Zeng YH, Shao Y, He BC, Liu H. Follicle-Stimulating Hormone β-Subunit Potentiates Bone Morphogenetic Protein 9-Induced Osteogenic Differentiation in Mouse Embryonic Fibroblasts. J Cell Biochem. 2017 Jul;118(7):1792-1802. doi: 10.1002/jcb.25849. Epub 2017 Mar 17. PMID: 27996168. |
|---|
