Primary Information |
|---|
| BoMiProt ID | Bomi5782 |
|---|
| Protein Name | Fibroblast growth factor 5 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A0MTF4 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001071479.2 |
|---|
| Aminoacid Length | 270 |
|---|
| Molecular Weight | 29641 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | FGF5 |
|---|
| Gene ID | 536771 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | regulation of cell proliferation and cell differentiation via ERK and AKT activation.an inhibitor of hair elongation |
|---|
| Significance in milk | Milk derived growth factors are important for treatment of gastrointestinal disorders and skin diseases, wound healing, and induction of oral tolerance.Stimulates the proliferation of epidermal, epithelial and embryonic cells.Inhibits the secretion of gastric acid.Promotes wound healing and bone resorption |
|---|
| PTMs | N linked glycosylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A0MTF4|FGF5_BOVIN Fibroblast growth factor 5 OS=Bos taurus OX=9913 GN=FGF5 PE=2 SV=1
MSLSFLLLLFLSHLILSAWAQGEKRLAPKGQPGPAATERNPGGASSRRSSSSTATSSSSP
ASSSSAASRGGPGSSLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVN*112GSHEANML
SILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAI
HRTEKTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQLEQPELSFTVTVPEKKK
PPNPVKPKVPLSAPRRSPNTVKYRLKFRFG |
|---|
| Predicted Disorder Regions | 20-84, 200-213, 239-260 |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | N terminal glycosylated sequence is important for it's secretion and its full activation. |
|---|
| Bibliography | 1.Bates B, Hardin J, Zhan X, Drickamer K, Goldfarb M. Biosynthesis of human fibroblast growth factor-5. Mol Cell Biol. 1991 Apr;11(4):1840-5. doi: 10.1128/mcb.11.4.1840-1845.1991. PMID: 2005884; PMCID: PMC359856. 2.Hébert JM, Rosenquist T, Götz J, Martin GR. FGF5 as a regulator of the hair growth cycle: evidence from targeted and spontaneous mutations. Cell. 1994 Sep 23;78(6):1017-25. doi: 10.1016/0092-8674(94)90276-3. PMID: 7923352. |