Primary Information |
---|
BoMiProt ID | Bomi5624 |
---|
Protein Name | Eukaryotic translation initiation factor 3 subunit M |
---|
Organism | Bos taurus |
---|
Uniprot ID | Q3T148 |
---|
Milk Fraction | Exosomes |
---|
Ref Sequence ID | NP_001030389.2 |
---|
Aminoacid Length | 373 |
---|
Molecular Weight | 42416 |
---|
FASTA Sequence |
Download |
---|
Gene Name | EIF3M |
---|
Gene ID | 515543 |
---|
Protein Existence Status | Reviewed |
---|
Secondary Information |
---|
Protein Function | It is a component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex. The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. |
---|
PTMs | Phosphorylation at Ser,N-acetylation at Ser |
---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T148|EIF3M_BOVIN Eukaryotic translation initiation factor 3 subunit M OS=Bos taurus OX=9913 GN=EIF3M PE=2 SV=2
MS*2VPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDV
ESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVR
YTVYCSLIKVAASCGAIQYIPTELDQVRKWIS*152DWNLTTEKKHTLLRLLYEALVDCKKSDA
ASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDL
LTIFVSAKLAYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQEL
QIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNL
NKVKNS*366LLSLSDT |
---|
Predicted Disorder Regions | NA |
---|
DisProt Annotation | |
---|
TM Helix Prediction | No TM helices |
---|
Bibliography | 1.Cheshenko N, Trepanier JB, Segarra TJ, Fuller AO, Herold BC. HSV usurps eukaryotic initiation factor 3 subunit M for viral protein translation: novel prevention target. PLoS One. 2010 Jul 27;5(7):e11829. doi: 10.1371/journal.pone.0011829. PMID: 20676407; PMCID: PMC2910742. |