Primary Information |
|---|
| BoMiProt ID | Bomi5622 |
|---|
| Protein Name | Eukaryotic translation initiation factor 3 subunit K/Eukaryotic translation initiation factor 3 subunit 12/eIF-3 p25 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3T0V3 |
|---|
| Milk Fraction | Exosomes |
|---|
| Ref Sequence ID | NP_001029661.1 |
|---|
| Aminoacid Length | 218 |
|---|
| Molecular Weight | 25074 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | EIF3K |
|---|
| Gene ID | 515326 |
|---|
| Protein Existence Status | Reviewed |
|---|
Secondary Information |
|---|
| Presence in other biological fluids/tissue/cells | vertebral column |
|---|
| Protein Function | It is aomponent of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex |
|---|
| PTMs | N-acetylation at Alanine,Phosphorylation at Ser/Thr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T0V3|EIF3K_BOVIN Eukaryotic translation initiation factor 3 subunit K OS=Bos taurus OX=9913 GN=EIF3K PE=2 SV=1
MAMFEQMRANVGKLLKGIDRYNPENLAT*28LERYVETQAKENAYDLEANLAVLKLYQFNPAF
FQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQA
LDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLTDSQLKVWMSKYGWS
ADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASS*217Q |
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Additional Comments | Individual overexpression of five subunits of human translation initiation factor eIF3 promotes malignant transformation of immortal fibroblast cells. |
|---|
| Bibliography | 1.Smith MD, Gu Y, Querol-Audí J, Vogan JM, Nitido A, Cate JH. Human-like eukaryotic translation initiation factor 3 from Neurospora crassa. PLoS One. 2013 Nov 8;8(11):e78715. doi: 10.1371/journal.pone.0078715. PMID: 24250809; PMCID: PMC3826745. 2.Zhang L, Pan X, Hershey JW (2007) Individual overexpression of five subunits of human translation initiation factor eIF3 promotes malignant transformation of immortal fibroblast cells. The Journal of Biological Chemistry 282: 5790–5800. |
|---|
