Primary Information |
|---|
| BoMiProt ID | Bomi5510 |
|---|
| Protein Name | Engulfment and cell motility protein 2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | A4FUD6 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001076860.1 |
|---|
| Aminoacid Length | 720 |
|---|
| Molecular Weight | 82589 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | ELMO2 |
|---|
| Gene ID | 508361 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | regulator of insulin-dependent Glut4 membrane translocation through modulating Rac1 activity and Akt membrane compartmentalization.interaction of Elmo1/2 with BAI (brain-specific angiogenesis inhibitor) recruits them onto the proximal membrane to activate the small GTPase Rac1 through the Dock180 guanine nucleotide exchange factor to mediate engulfment of apoptotic cells or to promote muscle differentiation. |
|---|
| Biochemical Properties | contains Ras GTPase-binding domain,a pleckstrin homology(PH) domain and a proline-rich region .Interacts directly with the SH3-domain of DOCK1 via its SH3-binding site |
|---|
| PTMs | phosphorylation on Ser and Tyr |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|A4FUD6|ELMO2_BOVIN Engulfment and cell motility protein 2 OS=Bos taurus OX=9913 GN=ELMO2 PE=2 SV=1
MPPPSDIVKVAIEWPGANAQLLEIDQKRPLASIIKEVCDGWSLPNPEY*48YTLRYADGPQLY
ITEQTRSDIKNGTILQLAISPSRAARQLMERTQSSSMETRLDAMKELAKLSADVTFATEF
INMDGIVVLTRLVESGTKLLSHYSEMLAFTLTAFLELMDHGIVSWDMVSITFIKQIAGYV
SQPMVDVSILQRSLAILESMVLNSQSLYQKIAEEITVGQLISHLQVSNQEIQTYAIALIN
ALFLKAPEDKRQDMANAFAQKHLRSIILNHVIRGNRPIKTEMAHQLYVLQVLTFNLLEER
MMTKMDPNDQAQRDIIFELRRIAFDADSDPSNAPGSGTEKRKAMYTKDYKMLGFTNHINP
AMDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGRSAIELTKMLCEI
LQVGELPNEGRNDYHPMFFTHDRAFEELFGICIQLLNKTWKEMRATAEDFNKVMQVVREQ
ITRALPSKPNSLDQFKSKLRSLS*503YSEILRLRQSERMSQDDFQSPPIVELREKIQPEILEL
IKQQRLNRLCEGSSFRKIGNRRRQERFWYCRLALNHKVLHYGDLDDNPQGEVTFESLQEK
IPVADIKAIVTGKDCPHMKEKSALKQNKEVLELAFSILYDPDETLNFIAPNKYEYCIWID
GLSALLGKDMSSELTKSDRDTLLSMEMKLRLLDLENIQIPEAPPPVPKEPSSYDFVY*717HYG |
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Significance of PTMs | Insulin promotes tyrosine phosphorylation. Axl phosphorylates Elmo1/2 on a conserved carboxyl-terminal tyrosine residue. Upon Gas6-dependent activation of Axl, endogenous Elmo2 becomes phosphorylated on Tyr-713 and enters into a physical complex with Axl in breast cancer cells,which is required for cell invasion and cell migration. tyrosine-phosphorylated residue Y713 in Elmo2 becomes a docking site for other signaling molecules,which can increase Rac binding and GEF activity . |
|---|
| Bibliography | 1.Abu-Thuraia A, Gauthier R, Chidiac R, Fukui Y, Screaton RA, Gratton JP, Côté JF. Axl phosphorylates Elmo scaffold proteins to promote Rac activation and cell invasion. Mol Cell Biol. 2015 Jan;35(1):76-87. doi: 10.1128/MCB.00764-14. Epub 2014 Oct 20. PMID: 25332238; PMCID: PMC4295393. 2.Sun Y, Côté JF, Du K. Elmo2 Is a Regulator of Insulin-dependent Glut4 Membrane Translocation. J Biol Chem. 2016 Jul 29;291(31):16150-61. doi: 10.1074/jbc.M116.731521. Epub 2016 May 20. PMID: 27226625; PMCID: PMC4965564. |