Primary Information |
|---|
| BoMiProt ID | Bomi5505 |
|---|
| Protein Name | Endothelial diferentiation-related factor 1 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q3T0V7 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001030384.1 |
|---|
| Aminoacid Length | 148 |
|---|
| Molecular Weight | 16369 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | EDF1 |
|---|
| Gene ID | 515380 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | repression of endothelial cell differentiation. it regulates CaM availability in the cytosol. it acts in the nucleus as a transcriptional coactivator. |
|---|
| PTMs | Acetylation on Ala, Methylation on Lys, Phosphorylation on Ser |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q3T0V7|EDF1_BOVIN Endothelial differentiation-related factor 1 OS=Bos taurus OX=9913 GN=EDF1 PE=2 SV=1
MAES*4DWDTVTVLRKKGPTAAQAKSKQAILAAQRRGEDVETSKKWAAGQNKQHSITKNTAK
LDRETEELHHDRVTLEVGKVIQQGRQSKGLTQKDLATKINEKPQVIADYESGRAIPNNQV
LGKIERAIGLKLRGKDIGKPIEKGPRAK |
|---|
| Predicted Disorder Regions | 3 disordered segments; (1-105), (109-123), (129-148) |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Ballabio E, Mariotti M, De Benedictis L, Maier JA. The dual role of endothelial differentiation-related factor-1 in the cytosol and nucleus: modulation by protein kinase A. Cell Mol Life Sci. 2004 May;61(9):1069-74. doi: 10.1007/s00018-004-4016-0. PMID: 15112053. |
|---|
