Primary Information |
|---|
| BoMiProt ID | Bomi5503 |
|---|
| Protein Name | Endoribonuclease LACTB2/Beta-lactamase-like protein 2 |
|---|
| Organism | Bos taurus |
|---|
| Uniprot ID | Q1LZ83 |
|---|
| Milk Fraction | Whey |
|---|
| Ref Sequence ID | NP_001069513.1 |
|---|
| Aminoacid Length | 288 |
|---|
| Molecular Weight | 32683 |
|---|
| FASTA Sequence |
Download |
|---|
| Gene Name | LACTB2 |
|---|
| Gene ID | 535021 |
|---|
| Protein Existence Status | reviewed |
|---|
Secondary Information |
|---|
| Protein Function | Display endoribonuclease activity on ssRNA with a preference for cleavage after purine-pyrimidine sequences.involved in the turnover of mitochondrial RNA, and is essential for mitochondrial function in human cells. |
|---|
| Biochemical Properties | Has no activity with double-stranded RNA or DNA.cleaves preferentially 3' to purine-pyrimidine dinucleotide motifs in single-stranded RNA. Binds 2 Zn2+ ions per subunit. |
|---|
| Significance in milk | beta lactoglobulin synthesis |
|---|
| PTMs | Acetylation,Phosphorylation |
|---|
Site(s) of PTM(s)
N-glycosylation,
O-glycosylation,
Phosphorylation
| >sp|Q1LZ83|LACB2_BOVIN Endoribonuclease LACTB2 OS=Bos taurus OX=9913 GN=LACTB2 PE=2 SV=1
MAATLQRIERLSSRVIRVLGCNPGPMTLQGTNTYLVGTGPRRILIDTGEPSIPEYISCLK
QALTEFNTAIQEIIVTHWHRDHTGGIGDICKSINNDTTYCVKKLPRNPERKEIIGNGEQQ
YVYVKDGDIIKTEGATLRVVYTPGHTDDHMALVLEEENALFSGDCILGEGTTVFEDLYDY
MNSLKELLKIKAKVIYPGHGPVIHNAEAKILQYISHRNIREQQILTVFHENFEKS*235FTAME
LVKSIYKDTPEHLHKMAQHNVLLHLKKLEKEGKIVSNTDPEKKWKAHL |
|---|
| Predicted Disorder Regions | NA |
|---|
| DisProt Annotation | |
|---|
| TM Helix Prediction | No TM helices |
|---|
| Bibliography | Levy S, Allerston CK, Liveanu V, Habib MR, Gileadi O, Schuster G. Identification of LACTB2, a metallo-β-lactamase protein, as a human mitochondrial endoribonuclease. Nucleic Acids Res. 2016 Feb 29;44(4):1813-32. doi: 10.1093/nar/gkw050. Epub 2016 Jan 29. PMID: 26826708; PMCID: PMC4770246. |
|---|
